PRSS3 (serine protease 3)

Gene

• Entrez ID: 5646
• Gene name: Serine protease 3
• Gene symbol: PRSS3
• Synonyms: MTG, PRSS4, T9, TRY3, TRY4
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group o

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	IDA	6698368, 11827488, 14507909
GO:0005509	Function	Calcium ion binding	IDA	6698368, 11827488
GO:0005515	Function	Protein binding	IPI	6698368, 14507909
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	6698368
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	6698368, 11827488
GO:0006508	Process	Proteolysis	NAS	8294000
GO:0007586	Process	Digestion	TAS	6698368, 14507909
GO:0009235	Process	Cobalamin metabolic process	TAS
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0031638	Process	Zymogen activation	IDA	6698368
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043542	Process	Endothelial cell migration	IMP	15313892
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 613578
• HGNC: 9486
• e!Ensembl: ENSG00000010438

Protein

• UniProt ID: P35030
• Protein name: Trypsin-3 (EC 3.4.21.4) (Brain trypsinogen) (Mesotrypsin) (Mesotrypsinogen) (Serine protease 3) (Serine protease 4) (Trypsin III) (Trypsin IV)
• Protein function: Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors. {ECO:0000269|PubMed:11827488, ECO:0000269|PubMed:14507909, ECO:0000269|PubMed:18077447, ECO:0000269|
• PDB: 1H4W, 2R9P, 3L33, 3L3T, 3P92, 3P95, 4DG4, 4U30, 4U32, 5C67, 5JBT, 5TP0, 6BX8, 6GFI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	81 → 296	Trypsin	Domain

• Sequence:

  MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAAR
  DADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
  CYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARV
  STISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSM
  FCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTI
  AANS

• Sequence length: 304

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A

Reactome:

Alpha-defensins
Cobalamin (Cbl, vitamin B12) transport and metabolism
Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Urinary bladder cancer	Malignant neoplasm of urinary bladder		15987713
Bladder neoplasm	Bladder Neoplasm		15987713