PRSS2 (serine protease 2)

Gene

• Entrez ID: 5645
• Gene name: Serine protease 2
• Gene symbol: PRSS2
• Synonyms: TRY2, TRY8, TRYP2
• Chromosome: 7
• Chromosome location: 7q34
• Summary: This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysin

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	IDA	12709065, 12731883
GO:0005509	Function	Calcium ion binding	IDA	12709065
GO:0005515	Function	Protein binding	IPI	16192646
GO:0005576	Component	Extracellular region	IDA	12731883
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IMP	16192646
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	12731883
GO:0007586	Process	Digestion	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030307	Process	Positive regulation of cell growth	TAS	12731883
GO:0030574	Process	Collagen catabolic process	IDA	12731883
GO:0030574	Process	Collagen catabolic process	IMP	16192646
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	TAS	12731883
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045785	Process	Positive regulation of cell adhesion	TAS	12731883

Other IDs

• MIM: 601564
• HGNC: 9483
• e!Ensembl: ENSG00000275896

Protein

• UniProt ID: P07478
• Protein name: Trypsin-2 (EC 3.4.21.4) (Anionic trypsinogen) (Serine protease 2) (Trypsin II)
• Protein function: In the ileum, may be involved in defensin processing, including DEFA5.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	24 → 239	Trypsin	Domain

• Sequence:

  MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
  AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
  SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
  NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
  DTIAANS

• Sequence length: 247

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A

Reactome:

Collagen degradation
Alpha-defensins
Activation of Matrix Metalloproteinases
Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261
Hereditary pancreatitis	Hereditary pancreatitis, Hereditary chronic pancreatitis	rs113993960, rs113993959, rs75527207, rs80034486, rs121909294, rs111033565, rs111033566, rs111033567, rs267606982, rs111033568, rs17107315, rs104893938, rs104893939, rs387906698, rs193922659, rs397507439, rs202003805, rs121908774, rs397508198, rs397508387, rs121909034, rs397508706, rs374705585, rs148954387, rs515726210, rs199769221, rs1805177, rs797045159, rs3034796, rs1060503164, rs1554382608, rs121909005, rs369503365, rs1554089895, rs1557508272, rs747905422, rs1562898489, rs1561606446, rs766917452, rs1570784592	18461367, 16699518

Unknown
Disease name	Disease term	dbSNP ID	References
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency
Pancreatic pseudocyst	Pancreatic Pseudocyst
Pancreatitis	Pancreatitis, Pancreatitis, Chronic, Autosomal Dominant Hereditary Pancreatitis, Recurrent pancreatitis	rs61734659	16699518, 18206817
Pleural effusion	Pleural effusion disorder
Splanchnic vein thrombosis	Splanchnic vein thrombosis