AZGP1 (alpha-2-glycoprotein 1, zinc-binding)

Gene

• Entrez ID: 563
• Gene name: Alpha-2-glycoprotein 1, zinc-binding
• Gene symbol: AZGP1
• Synonyms: ZA2G, ZAG
• Chromosome: 7
• Chromosome location: 7q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022028	hsa-miR-128-3p	Microarray	17612493
MIRT2179179	hsa-miR-188-3p	CLIP-seq
MIRT2179180	hsa-miR-3152-5p	CLIP-seq
MIRT2179181	hsa-miR-3691-3p	CLIP-seq
MIRT2179182	hsa-miR-4317	CLIP-seq
MIRT2179183	hsa-miR-888	CLIP-seq
MIRT2179184	hsa-miR-934	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0001895	Process	Retina homeostasis	HEP	23580065
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA	21873635
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA	21873635
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA	21873635
GO:0004540	Function	Ribonuclease activity	NAS	10462714
GO:0005515	Function	Protein binding	IPI	16237761, 18930737, 28671123, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006955	Process	Immune response	IBA	21873635
GO:0007155	Process	Cell adhesion	IDA	9813179
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	10462714
GO:0008320	Function	Protein transmembrane transporter activity	NAS	6896906
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0055085	Process	Transmembrane transport	TAS
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071806	Process	Protein transmembrane transport	IEA
GO:0090501	Process	RNA phosphodiester bond hydrolysis	IEA

Other IDs

• MIM: 194460
• HGNC: 910
• e!Ensembl: ENSG00000160862

Protein

• UniProt ID: P25311
• Protein name: Zinc-alpha-2-glycoprotein (Zn-alpha-2-GP) (Zn-alpha-2-glycoprotein)
• Protein function: Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. May bind polyunsaturated fatty acids.
• PDB: 1T7V, 1T7W, 1T7X, 1T7Y, 1T7Z, 1T80, 1ZAG, 3ES6, 6R2U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	26 → 201	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
  PF07654	C1-set	208 → 287	Immunoglobulin C1-set domain	Domain

• Sequence:

  MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
  YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
  FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
  YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
  RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS

• Sequence length: 298

Pathways

Reactome:

Miscellaneous transport and binding events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	18978557
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	18978557
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	18978557
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17173048

Unknown
Disease name	Disease term	dbSNP ID	References
Lung neoplasms	Lung Neoplasms		18978557
Sclerocystic ovaries	Sclerocystic Ovaries		21411543
Polycystic ovary syndrome	Polycystic Ovary Syndrome		21411543
Prostatic neoplasms	Prostatic Neoplasms		17173048
Sinusitis	Sinusitis		18391768