MAP2K5 (mitogen-activated protein kinase kinase 5)

Gene

• Entrez ID: 5607
• Gene name: Mitogen-activated protein kinase kinase 5
• Gene symbol: MAP2K5
• Synonyms: HsT17454, MAPKK5, MEK5, PRKMK5
• Chromosome: 15
• Chromosome location: 15q23
• Summary: The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018716	hsa-miR-335-5p	Microarray	18185580
MIRT024959	hsa-miR-214-3p	Microarray;Other	19859982
MIRT438086	hsa-miR-330-3p	Genotyping	24436253
MIRT438086	hsa-miR-330-3p	Genotyping	24436253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0000187	Process	Activation of MAPK activity	ISS	20551324
GO:0004672	Function	Protein kinase activity	TAS	7759517
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7759517, 14743216, 17474147, 18588859, 21516116, 21988832, 22939624, 25241761, 28514442, 29892012, 31515488, 31980649, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IEA
GO:0007165	Process	Signal transduction	TAS	7759517
GO:0007507	Process	Heart development	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	ISS	20551324
GO:0032717	Process	Negative regulation of interleukin-8 production	ISS	20551324
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	ISS	20551324
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0060761	Process	Negative regulation of response to cytokine stimulus	ISS	20551324
GO:0070375	Process	ERK5 cascade	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS	20551324
GO:0071499	Process	Cellular response to laminar fluid shear stress	TAS	20551324
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	ISS	20551324
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	ISS	20551324
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	20551324

Other IDs

• MIM: 602520
• HGNC: 6845
• e!Ensembl: ENSG00000137764

Protein

• UniProt ID: Q13163
• Protein name: Dual specificity mitogen-activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5)
• Protein function: Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac developme
• PDB: 2NPT, 2O2V, 4IC7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00564	PB1	18 → 100	PB1 domain	Domain
  PF00069	Pkinase	166 → 419	Protein kinase domain	Domain

• Sequence:

  MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
  EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
  KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
  YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
  TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
  DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
  KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
  QFNDGNAAVVSMWVCRALEERRSQQGPP

• Sequence length: 448

Pathways

KEGG:

MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Fluid shear stress and atherosclerosis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	23563607

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Depressive disorder	rs587778876, rs587778877	24436253
Motion sickness	Motion Sickness		25628336
Restless legs syndrome	Restless Legs Syndrome		29029846, 17637780, 21779176