MAPK8 (mitogen-activated protein kinase 8)

Gene

• Entrez ID: 5599
• Gene name: Mitogen-activated protein kinase 8
• Gene symbol: MAPK8
• Synonyms: JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
• Chromosome: 10
• Chromosome location: 10q11.22
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003985	hsa-miR-199a-3p	Western blot	18456660
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT016104	hsa-miR-421	Sequencing	20371350
MIRT016510	hsa-miR-193b-3p	Microarray	20304954
MIRT021289	hsa-miR-125a-5p	Sequencing	20371350
MIRT021678	hsa-miR-140-3p	Sequencing	20371350
MIRT005427	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT025602	hsa-miR-10a-5p	Sequencing	20371350
MIRT028235	hsa-miR-33a-5p	Sequencing	20371350
MIRT016104	hsa-miR-421	CLASH	23622248
MIRT037323	hsa-miR-877-5p	CLASH	23622248
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT736095	hsa-miR-141-3p	qRT-PCR	33133155
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT473699	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35001794
MIRT2037380	hsa-miR-1244	CLIP-seq
MIRT2037381	hsa-miR-3168	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	20800677
E2F3	Unknown	20800677
HSF2	Repression	11557063
JUN	Activation	19324081
JUN	Unknown	16397260

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14967141, 15850461, 20027304, 21095239, 22966201
GO:0004705	Function	JUN kinase activity	IBA	21873635
GO:0004705	Function	JUN kinase activity	IDA	8654373, 21095239
GO:0004705	Function	JUN kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10393177, 10490659, 10747973, 10856240, 11517249, 15334056, 15894542, 16291755, 16533805, 16840345, 16982329, 18003900, 18286207, 19234442, 19527717, 22966201, 23397142, 25241761, 25284480, 27043084
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20027304, 30878395
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	21856198
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0006979	Process	Response to oxidative stress	IDA	22966201
GO:0007254	Process	JNK cascade	IBA	21873635
GO:0007254	Process	JNK cascade	IDA	8654373
GO:0007254	Process	JNK cascade	TAS
GO:0007258	Process	JUN phosphorylation	IDA	14967141, 21095239
GO:0009411	Process	Response to UV	IDA	14967141
GO:0009612	Process	Response to mechanical stimulus	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0016241	Process	Regulation of macroautophagy	TAS	26546165
GO:0016301	Function	Kinase activity	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15850461, 20027304, 21095239, 22966201
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	21095239
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	20027304
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0030424	Component	Axon	ISS	22683681
GO:0031063	Process	Regulation of histone deacetylation	IEA
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0032091	Process	Negative regulation of protein binding	IDA	21095239
GO:0032880	Process	Regulation of protein localization	IDA	20027304
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	26514923
GO:0035033	Function	Histone deacetylase regulator activity	IMP	20027304
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	20027304
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	14967141, 21095239
GO:0045202	Component	Synapse	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22027397
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071276	Process	Cellular response to cadmium ion	IMP	26514923
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0090045	Process	Positive regulation of deacetylase activity	IMP	20027304
GO:0097441	Component	Basal dendrite	ISS	22683681
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS
GO:1902595	Process	Regulation of DNA replication origin binding	IMP	21856198

Other IDs

• MIM: 601158
• HGNC: 6881
• e!Ensembl: ENSG00000107643

Protein

• UniProt ID: P45983
• Protein name: Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1)
• Protein function: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate
• PDB: 1UKH, 1UKI, 2G01, 2GMX, 2H96, 2NO3, 2XRW, 2XS0, 3ELJ, 3O17, 3O2M, 3PZE, 3V3V, 3VUD, 3VUG, 3VUH, 3VUI, 3VUK, 3VUL, 3VUM, 4AWI, 4E73, 4G1W, 4HYS, 4HYU, 4IZY, 4L7F, 4QTD, 4UX9, 4YR8, 5LW1, 6F5E, 6ZR5, 8PT8, 8PT9, 8PTA, 8R5E, 8X5M, 9FT9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	26 → 321	Protein kinase domain	Domain

• Sequence:

  MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
  FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
  MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
  MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
  LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
  MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
  MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
  GPLGCCR

• Sequence length: 427

Pathways

KEGG:

Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Necroptosis
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Alcoholic liver disease
Alzheimer disease
Parkinson disease
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Yersinia infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Diabetic cardiomyopathy
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Activation of BIM and translocation to mitochondria
Activation of BMF and translocation to mitochondria
NRAGE signals death through JNK
Oxidative Stress Induced Senescence
FCERI mediated MAPK activation
DSCAM interactions
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Activation of the AP-1 family of transcription factors
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Interleukin-38 signaling
WNT5:FZD7-mediated leishmania damping

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	28789951
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	24046278
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	18593901
Glioblastoma	Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888
Liver failure	Liver Failure, Acute	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682	17185352
Renal carcinoma	Conventional (Clear Cell) Renal Cell Carcinoma	rs121913668, rs121913670, rs121913243, rs786202724
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	24284070

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema, Infantile		24046278
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	11751189, 21669197, 21669197, 11751189
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		18593901
Trigeminal neuralgia	Trigeminal Neuralgia, Trigeminal Neuralgia, Idiopathic, Secondary Trigeminal Neuralgia		27093858