HAUS7 (HAUS augmin like complex subunit 7)

Gene

• Entrez ID: 55559
• Gene name: HAUS augmin like complex subunit 7
• Gene symbol: HAUS7
• Synonyms: UCHL5IP, UIP1
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alte

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1041381	hsa-miR-3151	CLIP-seq
MIRT1041382	hsa-miR-337-5p	CLIP-seq
MIRT1041383	hsa-miR-4283	CLIP-seq
MIRT1041384	hsa-miR-4489	CLIP-seq
MIRT1041385	hsa-miR-4772-3p	CLIP-seq
MIRT1041386	hsa-miR-891a	CLIP-seq
MIRT2544649	hsa-miR-3064-3p	CLIP-seq
MIRT2544650	hsa-miR-3074-5p	CLIP-seq
MIRT2544651	hsa-miR-3158-3p	CLIP-seq
MIRT2544652	hsa-miR-3689a-3p	CLIP-seq
MIRT2544653	hsa-miR-3689c	CLIP-seq
MIRT2544654	hsa-miR-4707-3p	CLIP-seq
MIRT2544655	hsa-miR-4721	CLIP-seq
MIRT2544656	hsa-miR-4722-3p	CLIP-seq
MIRT2544657	hsa-miR-516a-3p	CLIP-seq
MIRT2544658	hsa-miR-635	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 19369198, 19447967, 20360068, 30723163, 32296183, 32814053
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	TAS
GO:0007098	Process	Centrosome cycle	IBA	21873635
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0031996	Function	Thioesterase binding	IPI	11163772
GO:0051011	Function	Microtubule minus-end binding	IBA	21873635
GO:0051225	Process	Spindle assembly	IBA	21873635
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IBA	21873635
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

Other IDs

• MIM: 300540
• HGNC: 32979
• e!Ensembl: ENSG00000213397

Protein

• UniProt ID: Q99871
• Protein name: HAUS augmin-like complex subunit 7 (26S proteasome-associated UCH37-interacting protein 1) (UCHL5-interacting protein) (X-linked protein STS1769)
• Protein function: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
• PDB: 7SQK
• Sequence:

  MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITE
  PKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCA
  PDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFS
  SPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLH
  ALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPD
  LHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLAT
  KMNELMEK

• Sequence length: 368

Pathways

Reactome:

Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Alopecia	Alopecia		28196072