SOX6 (SRY-box transcription factor 6)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
55553 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
SRY-box transcription factor 6 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
SOX6 |
SynonymsGene synonyms aliases
|
HSSOX6, SOXD, TOLCAS |
ChromosomeChromosome number
|
11 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
11p15.2 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The e |
miRNAmiRNA information provided by mirtarbase database.
|
miRTarBase ID |
miRNA |
Experiments |
Reference |
MIRT004658 |
hsa-miR-499a-5p |
Luciferase reporter assay |
20081117 |
MIRT003203 |
hsa-miR-1-3p |
Luciferase reporter assay |
20081117 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT006113 |
hsa-miR-155-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
21989846 |
MIRT052901 |
hsa-miR-16-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
24852767 |
MIRT052901 |
hsa-miR-16-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
24852767 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT438545 |
hsa-miR-208a-3p |
Luciferase reporter assay, Western blot |
25023649 |
MIRT554050 |
hsa-miR-19b-3p |
PAR-CLIP |
21572407 |
MIRT554049 |
hsa-miR-19a-3p |
PAR-CLIP |
21572407 |
MIRT554048 |
hsa-miR-548n |
PAR-CLIP |
21572407 |
MIRT554047 |
hsa-miR-651-3p |
PAR-CLIP |
21572407 |
MIRT554046 |
hsa-miR-562 |
PAR-CLIP |
21572407 |
MIRT554044 |
hsa-miR-3148 |
PAR-CLIP |
21572407 |
MIRT554045 |
hsa-miR-4668-5p |
PAR-CLIP |
21572407 |
MIRT732043 |
hsa-miR-1269a |
Luciferase reporter assay, qRT-PCR |
26692953 |
MIRT732043 |
hsa-miR-1269a |
Luciferase reporter assay, qRT-PCR |
26692953 |
MIRT004658 |
hsa-miR-499a-5p |
Luciferase reporter assay, Western blotting, qRT-PCR |
31938895 |
MIRT735531 |
hsa-miR-342-3p |
Luciferase reporter assay, qRT-PCR, Western blotting |
31746345 |
MIRT736668 |
hsa-miR-17-3p |
Luciferase reporter assay, Western blotting, qRT-PCR |
32946669 |
MIRT737252 |
hsa-miR-21-5p |
Luciferase reporter assay, Western blotting, qRT-PCR |
32757994 |
MIRT554050 |
hsa-miR-19b-3p |
PAR-CLIP |
21572407 |
MIRT554049 |
hsa-miR-19a-3p |
PAR-CLIP |
21572407 |
MIRT554048 |
hsa-miR-548n |
PAR-CLIP |
21572407 |
MIRT554047 |
hsa-miR-651-3p |
PAR-CLIP |
21572407 |
MIRT554046 |
hsa-miR-562 |
PAR-CLIP |
21572407 |
MIRT554044 |
hsa-miR-3148 |
PAR-CLIP |
21572407 |
MIRT554045 |
hsa-miR-4668-5p |
PAR-CLIP |
21572407 |
MIRT756245 |
hsa-miR-23a-3p |
Luciferase reporter assay |
37372085 |
MIRT756255 |
hsa-miR-23b-3p |
Luciferase reporter assay |
37372085 |
MIRT1380641 |
hsa-let-7a |
CLIP-seq |
|
MIRT1380642 |
hsa-let-7b |
CLIP-seq |
|
MIRT1380643 |
hsa-let-7c |
CLIP-seq |
|
MIRT1380644 |
hsa-let-7d |
CLIP-seq |
|
MIRT1380645 |
hsa-let-7e |
CLIP-seq |
|
MIRT1380646 |
hsa-let-7f |
CLIP-seq |
|
MIRT1380647 |
hsa-let-7g |
CLIP-seq |
|
MIRT1380648 |
hsa-let-7i |
CLIP-seq |
|
MIRT1380649 |
hsa-miR-1202 |
CLIP-seq |
|
MIRT1380650 |
hsa-miR-1207-3p |
CLIP-seq |
|
MIRT1380651 |
hsa-miR-1227 |
CLIP-seq |
|
MIRT1380652 |
hsa-miR-1231 |
CLIP-seq |
|
MIRT1380653 |
hsa-miR-1302 |
CLIP-seq |
|
MIRT1380654 |
hsa-miR-132 |
CLIP-seq |
|
MIRT1380655 |
hsa-miR-186 |
CLIP-seq |
|
MIRT1380656 |
hsa-miR-1910 |
CLIP-seq |
|
MIRT1380657 |
hsa-miR-19a |
CLIP-seq |
|
MIRT1380658 |
hsa-miR-19b |
CLIP-seq |
|
MIRT1380659 |
hsa-miR-202 |
CLIP-seq |
|
MIRT1380660 |
hsa-miR-2117 |
CLIP-seq |
|
MIRT1380661 |
hsa-miR-212 |
CLIP-seq |
|
MIRT1380662 |
hsa-miR-3121-5p |
CLIP-seq |
|
MIRT1380663 |
hsa-miR-3133 |
CLIP-seq |
|
MIRT1380664 |
hsa-miR-3138 |
CLIP-seq |
|
MIRT1380665 |
hsa-miR-3194-5p |
CLIP-seq |
|
MIRT1380666 |
hsa-miR-3646 |
CLIP-seq |
|
MIRT1380667 |
hsa-miR-375 |
CLIP-seq |
|
MIRT1380668 |
hsa-miR-3972 |
CLIP-seq |
|
MIRT1380669 |
hsa-miR-4273 |
CLIP-seq |
|
MIRT1380670 |
hsa-miR-4298 |
CLIP-seq |
|
MIRT1380671 |
hsa-miR-4458 |
CLIP-seq |
|
MIRT1380672 |
hsa-miR-4500 |
CLIP-seq |
|
MIRT1380673 |
hsa-miR-4520a-3p |
CLIP-seq |
|
MIRT1380674 |
hsa-miR-455-5p |
CLIP-seq |
|
MIRT1380675 |
hsa-miR-4642 |
CLIP-seq |
|
MIRT1380676 |
hsa-miR-4677-5p |
CLIP-seq |
|
MIRT1380677 |
hsa-miR-4711-5p |
CLIP-seq |
|
MIRT1380678 |
hsa-miR-4744 |
CLIP-seq |
|
MIRT1380679 |
hsa-miR-4773 |
CLIP-seq |
|
MIRT1380680 |
hsa-miR-4782-5p |
CLIP-seq |
|
MIRT1380681 |
hsa-miR-4800-5p |
CLIP-seq |
|
MIRT1380682 |
hsa-miR-526b |
CLIP-seq |
|
MIRT1380683 |
hsa-miR-576-3p |
CLIP-seq |
|
MIRT1380684 |
hsa-miR-654-3p |
CLIP-seq |
|
MIRT1380685 |
hsa-miR-98 |
CLIP-seq |
|
MIRT1380686 |
hsa-miR-223 |
CLIP-seq |
|
MIRT1380687 |
hsa-miR-3121-3p |
CLIP-seq |
|
MIRT1380688 |
hsa-miR-3163 |
CLIP-seq |
|
MIRT1380689 |
hsa-miR-338-3p |
CLIP-seq |
|
MIRT1380690 |
hsa-miR-34b |
CLIP-seq |
|
MIRT1380691 |
hsa-miR-34c-3p |
CLIP-seq |
|
MIRT1380692 |
hsa-miR-382 |
CLIP-seq |
|
MIRT1380693 |
hsa-miR-4668-3p |
CLIP-seq |
|
MIRT1380694 |
hsa-miR-4672 |
CLIP-seq |
|
MIRT1380695 |
hsa-miR-4697-3p |
CLIP-seq |
|
MIRT1380696 |
hsa-miR-4768-3p |
CLIP-seq |
|
MIRT1380697 |
hsa-miR-494 |
CLIP-seq |
|
MIRT1380649 |
hsa-miR-1202 |
CLIP-seq |
|
MIRT1380650 |
hsa-miR-1207-3p |
CLIP-seq |
|
MIRT1380698 |
hsa-miR-1207-5p |
CLIP-seq |
|
MIRT1380651 |
hsa-miR-1227 |
CLIP-seq |
|
MIRT1380653 |
hsa-miR-1302 |
CLIP-seq |
|
MIRT1380699 |
hsa-miR-208a |
CLIP-seq |
|
MIRT1380700 |
hsa-miR-208b |
CLIP-seq |
|
MIRT1380701 |
hsa-miR-3177-5p |
CLIP-seq |
|
MIRT1380665 |
hsa-miR-3194-5p |
CLIP-seq |
|
MIRT1380702 |
hsa-miR-3658 |
CLIP-seq |
|
MIRT1380668 |
hsa-miR-3972 |
CLIP-seq |
|
MIRT1380703 |
hsa-miR-4269 |
CLIP-seq |
|
MIRT1380670 |
hsa-miR-4298 |
CLIP-seq |
|
MIRT1380704 |
hsa-miR-4432 |
CLIP-seq |
|
MIRT1380705 |
hsa-miR-4514 |
CLIP-seq |
|
MIRT1380674 |
hsa-miR-455-5p |
CLIP-seq |
|
MIRT1380706 |
hsa-miR-4692 |
CLIP-seq |
|
MIRT1380707 |
hsa-miR-4742-5p |
CLIP-seq |
|
MIRT1380708 |
hsa-miR-4763-3p |
CLIP-seq |
|
MIRT1380709 |
hsa-miR-499-5p |
CLIP-seq |
|
MIRT1380710 |
hsa-miR-548v |
CLIP-seq |
|
MIRT1380683 |
hsa-miR-576-3p |
CLIP-seq |
|
MIRT1380711 |
hsa-miR-940 |
CLIP-seq |
|
MIRT1380712 |
hsa-miR-1179 |
CLIP-seq |
|
MIRT1380689 |
hsa-miR-338-3p |
CLIP-seq |
|
MIRT1380713 |
hsa-miR-4310 |
CLIP-seq |
|
MIRT1380697 |
hsa-miR-494 |
CLIP-seq |
|
MIRT1380714 |
hsa-miR-548m |
CLIP-seq |
|
MIRT1380715 |
hsa-miR-634 |
CLIP-seq |
|
MIRT1380641 |
hsa-let-7a |
CLIP-seq |
|
MIRT1380642 |
hsa-let-7b |
CLIP-seq |
|
MIRT1380643 |
hsa-let-7c |
CLIP-seq |
|
MIRT1380644 |
hsa-let-7d |
CLIP-seq |
|
MIRT1380645 |
hsa-let-7e |
CLIP-seq |
|
MIRT1380646 |
hsa-let-7f |
CLIP-seq |
|
MIRT1380647 |
hsa-let-7g |
CLIP-seq |
|
MIRT1380648 |
hsa-let-7i |
CLIP-seq |
|
MIRT1380659 |
hsa-miR-202 |
CLIP-seq |
|
MIRT1380687 |
hsa-miR-3121-3p |
CLIP-seq |
|
MIRT1380666 |
hsa-miR-3646 |
CLIP-seq |
|
MIRT1380671 |
hsa-miR-4458 |
CLIP-seq |
|
MIRT1380672 |
hsa-miR-4500 |
CLIP-seq |
|
MIRT1380682 |
hsa-miR-526b |
CLIP-seq |
|
MIRT1380685 |
hsa-miR-98 |
CLIP-seq |
|
MIRT2113971 |
hsa-miR-1290 |
CLIP-seq |
|
MIRT2113972 |
hsa-miR-1343 |
CLIP-seq |
|
MIRT2113973 |
hsa-miR-2113 |
CLIP-seq |
|
MIRT1380686 |
hsa-miR-223 |
CLIP-seq |
|
MIRT2113974 |
hsa-miR-3140-3p |
CLIP-seq |
|
MIRT2113975 |
hsa-miR-3150b-3p |
CLIP-seq |
|
MIRT2113976 |
hsa-miR-335 |
CLIP-seq |
|
MIRT2113977 |
hsa-miR-3941 |
CLIP-seq |
|
MIRT2113978 |
hsa-miR-3976 |
CLIP-seq |
|
MIRT1380669 |
hsa-miR-4273 |
CLIP-seq |
|
MIRT2113979 |
hsa-miR-4450 |
CLIP-seq |
|
MIRT2113980 |
hsa-miR-4476 |
CLIP-seq |
|
MIRT2113981 |
hsa-miR-450b-5p |
CLIP-seq |
|
MIRT2113982 |
hsa-miR-4667-5p |
CLIP-seq |
|
MIRT1380676 |
hsa-miR-4677-5p |
CLIP-seq |
|
MIRT2113983 |
hsa-miR-4693-3p |
CLIP-seq |
|
MIRT1380695 |
hsa-miR-4697-3p |
CLIP-seq |
|
MIRT2113984 |
hsa-miR-4698 |
CLIP-seq |
|
MIRT2113985 |
hsa-miR-4700-5p |
CLIP-seq |
|
MIRT2113986 |
hsa-miR-4784 |
CLIP-seq |
|
MIRT2113987 |
hsa-miR-485-3p |
CLIP-seq |
|
MIRT2113988 |
hsa-miR-507 |
CLIP-seq |
|
MIRT2113989 |
hsa-miR-520f |
CLIP-seq |
|
MIRT2113990 |
hsa-miR-539 |
CLIP-seq |
|
MIRT2113991 |
hsa-miR-557 |
CLIP-seq |
|
MIRT2113992 |
hsa-miR-574-5p |
CLIP-seq |
|
MIRT1380641 |
hsa-let-7a |
CLIP-seq |
|
MIRT1380642 |
hsa-let-7b |
CLIP-seq |
|
MIRT1380643 |
hsa-let-7c |
CLIP-seq |
|
MIRT1380644 |
hsa-let-7d |
CLIP-seq |
|
MIRT1380645 |
hsa-let-7e |
CLIP-seq |
|
MIRT1380646 |
hsa-let-7f |
CLIP-seq |
|
MIRT1380647 |
hsa-let-7g |
CLIP-seq |
|
MIRT1380648 |
hsa-let-7i |
CLIP-seq |
|
MIRT2336924 |
hsa-miR-1200 |
CLIP-seq |
|
MIRT2336925 |
hsa-miR-1206 |
CLIP-seq |
|
MIRT2336926 |
hsa-miR-128 |
CLIP-seq |
|
MIRT2336927 |
hsa-miR-1297 |
CLIP-seq |
|
MIRT1380654 |
hsa-miR-132 |
CLIP-seq |
|
MIRT2336928 |
hsa-miR-142-3p |
CLIP-seq |
|
MIRT2336929 |
hsa-miR-15a |
CLIP-seq |
|
MIRT2336930 |
hsa-miR-15b |
CLIP-seq |
|
MIRT2336931 |
hsa-miR-16 |
CLIP-seq |
|
MIRT1380656 |
hsa-miR-1910 |
CLIP-seq |
|
MIRT2336932 |
hsa-miR-195 |
CLIP-seq |
|
MIRT1380659 |
hsa-miR-202 |
CLIP-seq |
|
MIRT1380661 |
hsa-miR-212 |
CLIP-seq |
|
MIRT2336933 |
hsa-miR-2355-5p |
CLIP-seq |
|
MIRT2336934 |
hsa-miR-23a |
CLIP-seq |
|
MIRT2336935 |
hsa-miR-23b |
CLIP-seq |
|
MIRT2336936 |
hsa-miR-23c |
CLIP-seq |
|
MIRT2336937 |
hsa-miR-2467-5p |
CLIP-seq |
|
MIRT2336938 |
hsa-miR-2682 |
CLIP-seq |
|
MIRT2336939 |
hsa-miR-26a |
CLIP-seq |
|
MIRT2336940 |
hsa-miR-26b |
CLIP-seq |
|
MIRT2336941 |
hsa-miR-27a |
CLIP-seq |
|
MIRT2336942 |
hsa-miR-27b |
CLIP-seq |
|
MIRT2336943 |
hsa-miR-3117-5p |
CLIP-seq |
|
MIRT1380687 |
hsa-miR-3121-3p |
CLIP-seq |
|
MIRT2336944 |
hsa-miR-3132 |
CLIP-seq |
|
MIRT2336945 |
hsa-miR-3135b |
CLIP-seq |
|
MIRT2113975 |
hsa-miR-3150b-3p |
CLIP-seq |
|
MIRT2336946 |
hsa-miR-3188 |
CLIP-seq |
|
MIRT2336947 |
hsa-miR-3194-3p |
CLIP-seq |
|
MIRT2336948 |
hsa-miR-320e |
CLIP-seq |
|
MIRT2336949 |
hsa-miR-330-3p |
CLIP-seq |
|
MIRT2113976 |
hsa-miR-335 |
CLIP-seq |
|
MIRT2336950 |
hsa-miR-338-5p |
CLIP-seq |
|
MIRT1380666 |
hsa-miR-3646 |
CLIP-seq |
|
MIRT2336951 |
hsa-miR-3691-3p |
CLIP-seq |
|
MIRT1380667 |
hsa-miR-375 |
CLIP-seq |
|
MIRT2336952 |
hsa-miR-3921 |
CLIP-seq |
|
MIRT2336953 |
hsa-miR-3942-3p |
CLIP-seq |
|
MIRT2336954 |
hsa-miR-3942-5p |
CLIP-seq |
|
MIRT2336955 |
hsa-miR-3975 |
CLIP-seq |
|
MIRT2336956 |
hsa-miR-421 |
CLIP-seq |
|
MIRT2336957 |
hsa-miR-424 |
CLIP-seq |
|
MIRT1380703 |
hsa-miR-4269 |
CLIP-seq |
|
MIRT2336958 |
hsa-miR-4272 |
CLIP-seq |
|
MIRT2336959 |
hsa-miR-4282 |
CLIP-seq |
|
MIRT2336960 |
hsa-miR-4451 |
CLIP-seq |
|
MIRT1380671 |
hsa-miR-4458 |
CLIP-seq |
|
MIRT2336961 |
hsa-miR-4465 |
CLIP-seq |
|
MIRT2336962 |
hsa-miR-449c |
CLIP-seq |
|
MIRT1380672 |
hsa-miR-4500 |
CLIP-seq |
|
MIRT2336963 |
hsa-miR-4504 |
CLIP-seq |
|
MIRT1380705 |
hsa-miR-4514 |
CLIP-seq |
|
MIRT2336964 |
hsa-miR-4649-3p |
CLIP-seq |
|
MIRT2336965 |
hsa-miR-4653-5p |
CLIP-seq |
|
MIRT2336966 |
hsa-miR-4659a-3p |
CLIP-seq |
|
MIRT2336967 |
hsa-miR-4659b-3p |
CLIP-seq |
|
MIRT2336968 |
hsa-miR-4666-3p |
CLIP-seq |
|
MIRT1380694 |
hsa-miR-4672 |
CLIP-seq |
|
MIRT1380706 |
hsa-miR-4692 |
CLIP-seq |
|
MIRT2113983 |
hsa-miR-4693-3p |
CLIP-seq |
|
MIRT2113984 |
hsa-miR-4698 |
CLIP-seq |
|
MIRT2336969 |
hsa-miR-4703-3p |
CLIP-seq |
|
MIRT2336970 |
hsa-miR-4703-5p |
CLIP-seq |
|
MIRT2336971 |
hsa-miR-4704-5p |
CLIP-seq |
|
MIRT2336972 |
hsa-miR-4709-5p |
CLIP-seq |
|
MIRT2336973 |
hsa-miR-4715-3p |
CLIP-seq |
|
MIRT1380707 |
hsa-miR-4742-5p |
CLIP-seq |
|
MIRT2336974 |
hsa-miR-4775 |
CLIP-seq |
|
MIRT2336975 |
hsa-miR-4779 |
CLIP-seq |
|
MIRT2113986 |
hsa-miR-4784 |
CLIP-seq |
|
MIRT2336976 |
hsa-miR-485-5p |
CLIP-seq |
|
MIRT1380697 |
hsa-miR-494 |
CLIP-seq |
|
MIRT2336977 |
hsa-miR-497 |
CLIP-seq |
|
MIRT2336978 |
hsa-miR-498 |
CLIP-seq |
|
MIRT2336979 |
hsa-miR-505 |
CLIP-seq |
|
MIRT1380682 |
hsa-miR-526b |
CLIP-seq |
|
MIRT2336980 |
hsa-miR-548p |
CLIP-seq |
|
MIRT2336981 |
hsa-miR-548u |
CLIP-seq |
|
MIRT1380710 |
hsa-miR-548v |
CLIP-seq |
|
MIRT2113992 |
hsa-miR-574-5p |
CLIP-seq |
|
MIRT2336982 |
hsa-miR-607 |
CLIP-seq |
|
MIRT1380715 |
hsa-miR-634 |
CLIP-seq |
|
MIRT2336983 |
hsa-miR-765 |
CLIP-seq |
|
MIRT1380711 |
hsa-miR-940 |
CLIP-seq |
|
MIRT1380685 |
hsa-miR-98 |
CLIP-seq |
|
MIRT2460298 |
hsa-miR-1275 |
CLIP-seq |
|
MIRT2460299 |
hsa-miR-3183 |
CLIP-seq |
|
MIRT2460300 |
hsa-miR-326 |
CLIP-seq |
|
MIRT2460301 |
hsa-miR-330-5p |
CLIP-seq |
|
MIRT2460302 |
hsa-miR-3943 |
CLIP-seq |
|
MIRT2460303 |
hsa-miR-4271 |
CLIP-seq |
|
MIRT2460304 |
hsa-miR-4525 |
CLIP-seq |
|
MIRT2460305 |
hsa-miR-4665-5p |
CLIP-seq |
|
MIRT2113982 |
hsa-miR-4667-5p |
CLIP-seq |
|
MIRT2113983 |
hsa-miR-4693-3p |
CLIP-seq |
|
MIRT2113985 |
hsa-miR-4700-5p |
CLIP-seq |
|
MIRT2460306 |
hsa-miR-4723-3p |
CLIP-seq |
|
MIRT2460307 |
hsa-miR-4723-5p |
CLIP-seq |
|
MIRT2460308 |
hsa-miR-4725-3p |
CLIP-seq |
|
MIRT2113990 |
hsa-miR-539 |
CLIP-seq |
|
MIRT2113992 |
hsa-miR-574-5p |
CLIP-seq |
|
MIRT1380683 |
hsa-miR-576-3p |
CLIP-seq |
|
MIRT2460309 |
hsa-miR-625 |
CLIP-seq |
|
MIRT2460310 |
hsa-miR-637 |
CLIP-seq |
|
MIRT2460311 |
hsa-miR-671-5p |
CLIP-seq |
|
MIRT2460298 |
hsa-miR-1275 |
CLIP-seq |
|
MIRT2460299 |
hsa-miR-3183 |
CLIP-seq |
|
MIRT2460300 |
hsa-miR-326 |
CLIP-seq |
|
MIRT2460301 |
hsa-miR-330-5p |
CLIP-seq |
|
MIRT2460302 |
hsa-miR-3943 |
CLIP-seq |
|
MIRT2460303 |
hsa-miR-4271 |
CLIP-seq |
|
MIRT2460304 |
hsa-miR-4525 |
CLIP-seq |
|
MIRT2460305 |
hsa-miR-4665-5p |
CLIP-seq |
|
MIRT2113982 |
hsa-miR-4667-5p |
CLIP-seq |
|
MIRT2113985 |
hsa-miR-4700-5p |
CLIP-seq |
|
MIRT2460306 |
hsa-miR-4723-3p |
CLIP-seq |
|
MIRT2460307 |
hsa-miR-4723-5p |
CLIP-seq |
|
MIRT2460308 |
hsa-miR-4725-3p |
CLIP-seq |
|
MIRT2460309 |
hsa-miR-625 |
CLIP-seq |
|
MIRT2460310 |
hsa-miR-637 |
CLIP-seq |
|
MIRT2460311 |
hsa-miR-671-5p |
CLIP-seq |
|
MIRT2630410 |
hsa-miR-3074-5p |
CLIP-seq |
|
MIRT2630411 |
hsa-miR-3136-3p |
CLIP-seq |
|
MIRT2630410 |
hsa-miR-3074-5p |
CLIP-seq |
|
MIRT2630411 |
hsa-miR-3136-3p |
CLIP-seq |
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P35712 |
Protein name |
Transcription factor SOX-6 |
Protein function |
Transcription factor that plays a key role in several developmental processes, including neurogenesis, chondrocytes differentiation and cartilage formation (Probable). Specifically binds the 5'-AACAAT-3' DNA motif present in enhancers and super- |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00505 |
HMG_box |
621 → 689 |
HMG (high mobility group) box |
Domain |
|
Sequence |
MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLV STIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTP ERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGT PESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQ QQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKPG DNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNLDTFEHGGGHS YNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDI LSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNE KERTRFENLGPQLTGKSNEDGKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGA TVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWK SMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQE MRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTY GMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN
|
|
Sequence length |
828 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Coronary artery disease |
Coronary Artery Disease |
rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537 |
29212778 |
Obesity |
Obesity |
rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840 |
19714249 |
Osteoporosis |
Osteoporosis |
rs72658152, rs72667023, rs587776916, rs72656370, rs768615287 |
19714249 |
|
|
|
|