PPP3CC (protein phosphatase 3 catalytic subunit gamma)

Gene

• Entrez ID: 5533
• Gene name: Protein phosphatase 3 catalytic subunit gamma
• Gene symbol: PPP3CC
• Synonyms: CALNA3, CNA3, PP2Bgamma
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this g

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT1258258	hsa-miR-2052	CLIP-seq
MIRT1258259	hsa-miR-340	CLIP-seq
MIRT1258260	hsa-miR-3616-5p	CLIP-seq
MIRT1258261	hsa-miR-3647-5p	CLIP-seq
MIRT1258262	hsa-miR-382	CLIP-seq
MIRT1258263	hsa-miR-4670-3p	CLIP-seq
MIRT1258264	hsa-miR-501-3p	CLIP-seq
MIRT1258265	hsa-miR-502-3p	CLIP-seq
MIRT1258266	hsa-miR-573	CLIP-seq
MIRT2599446	hsa-miR-3148	CLIP-seq
MIRT2599447	hsa-miR-4282	CLIP-seq
MIRT2599448	hsa-miR-4434	CLIP-seq
MIRT2599449	hsa-miR-4516	CLIP-seq
MIRT2599450	hsa-miR-4531	CLIP-seq
MIRT2599451	hsa-miR-4668-5p	CLIP-seq
MIRT2599452	hsa-miR-4802-5p	CLIP-seq
MIRT2599453	hsa-miR-549	CLIP-seq
MIRT2599454	hsa-miR-579	CLIP-seq
MIRT2599455	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19154138
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005955	Component	Calcineurin complex	IBA	21873635
GO:0006470	Process	Protein dephosphorylation	IDA	19154138
GO:0007420	Process	Brain development	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	19154138
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IBA	21873635
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IDA	19154138
GO:0046872	Function	Metal ion binding	IEA
GO:0097720	Process	Calcineurin-mediated signaling	IBA	21873635
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA
GO:1900244	Process	Positive regulation of synaptic vesicle endocytosis	IEA
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS

Other IDs

• MIM: 114107
• HGNC: 9316
• e!Ensembl: ENSG00000120910

Protein

• UniProt ID: P48454
• Protein name: Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin, testis-specific catalytic subunit) (Calmodulin-dependent calcineurin A subunit gamma isoform)
• Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates
• PDB: 7U0T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00149	Metallophos	79 → 281	Calcineurin-like phosphoesterase	Domain

• Sequence:

  MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
  INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
  FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
  LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
  LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
  IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
  LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
  TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
  KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

• Sequence length: 512

Pathways

KEGG:

MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Cellular senescence
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Tuberculosis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Reactome:

Activation of BAD and translocation to mitochondria

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18343007, 23497497, 17339875, 24399042

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		19204725
Urinary bladder cancer	Malignant neoplasm of urinary bladder		29275364
Bladder neoplasm	Bladder Neoplasm		29275364
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	19204725
Nonorganic psychosis	Nonorganic psychosis		18343007
Psychosis	Psychotic Disorders		18343007