GediPNet logo

TMEM70 (transmembrane protein 70)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54968
Gene nameGene Name - the full gene name approved by the HGNC.
Transmembrane protein 70
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TMEM70
SynonymsGene synonyms aliases
MC5DN2
ChromosomeChromosome number
8
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.11
SummarySummary of gene provided in NCBI Entrez Gene.
This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113669789 C>T Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Intron variant
rs183973249 A>G,T Pathogenic Splice acceptor variant
rs199655842 T>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, missense variant, coding sequence variant, 3 prime UTR variant
rs200820631 C>T Likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant, 3 prime UTR variant
rs387907070 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT450648 hsa-miR-758-3p PAR-CLIP 22100165
MIRT450649 hsa-miR-578 PAR-CLIP 22100165
MIRT450650 hsa-miR-3611 PAR-CLIP 22100165
MIRT450651 hsa-miR-203a-3p PAR-CLIP 22100165
MIRT450652 hsa-miR-526b-5p PAR-CLIP 22100165
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005739 Component Mitochondrion IDA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9BUB7
Protein name Transmembrane protein 70, mitochondrial
Protein function Involved in biogenesis of mitochondrial ATP synthase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06979 TMEM70
107 240
Assembly, mitochondrial proton-transport ATP synth complex
Family
Sequence
MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAA
RLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLT
FLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYK
AITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDK

EEFILYMEETSEEKRHKDDK
Sequence length 260
Interactions View interactions
Associated diseases
Disease name Disease term References
Cardiomyopathies, Primary
Cardiomyopathies
Cerebral cortical atrophy
Congenital exomphalos
Congestive heart failure

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412