FEV (FEV transcription factor, ETS family member)

Gene

• Entrez ID: 54738
• Gene name: FEV transcription factor, ETS family member
• Gene symbol: FEV
• Synonyms: HSRNAFEV, PET-1
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT994888	hsa-miR-3125	CLIP-seq
MIRT994889	hsa-miR-3609	CLIP-seq
MIRT994890	hsa-miR-3916	CLIP-seq
MIRT994891	hsa-miR-548ah	CLIP-seq
MIRT994892	hsa-miR-548t	CLIP-seq
MIRT994893	hsa-miR-563	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994895	hsa-miR-877	CLIP-seq
MIRT2229088	hsa-miR-4476	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0042551	Process	Neuron maturation	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607150
• HGNC: 18562
• e!Ensembl: ENSG00000163497

Protein

• UniProt ID: Q99581
• Protein name: Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)
• Protein function: Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0
• PDB: 2YPR, 3ZP5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00178	Ets	48 → 127	Ets-domain	Domain

• Sequence:

  MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
  ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
  RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
  MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

• Sequence length: 238

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728, rs762292772, rs864321694, rs869312878, rs758432471, rs750896617, rs886039692, rs886039770, rs201037487, rs200483989, rs1057518198, rs1057517708, rs780267761, rs1555910143, rs1057519632, rs775225727, rs751037529, rs1064794848, rs1064795655, rs1131691548, rs1135401811, rs1553248081, rs1454466097, rs1554480537, rs1553578503, rs1553518509, rs774152851, rs1554481395, rs1554464807, rs1554401434, rs1452048149, rs370498156, rs756691187, rs1557863430, rs1557863440, rs1557863546, rs769581210, rs202098093, rs1276388879, rs778792467, rs760059077, rs373783340, rs1557867853, rs772572695, rs753214391, rs749270162, rs548226228, rs1557870645, rs1557874046, rs749548928, rs754532606, rs1557901347, rs1557902023, rs1557909572, rs574335012, rs1557909821, rs1372713010, rs561369202, rs1476293577, rs1557910728, rs1557911386, rs375045125, rs998675361, rs1557916296, rs1557935477, rs866632178, rs1561824498, rs1396313317, rs1564801388, rs1564801473, rs1564950387, rs1565527302, rs1569513495, rs1569305431, rs143944436, rs1563183492, rs1561846159, rs1565819425, rs1562957809, rs1585645641, rs1585016242, rs1595127294, rs1585667374, rs1585653028, rs1585653240, rs1592919048, rs1585645384, rs1789927813	31209396

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	24100022
Mood disorder	Mood Disorders		20480378
Myocardial ischemia	Myocardial Ischemia		16214533