GediPNet logo

POU5F1 (POU class 5 homeobox 1)
Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5460
Gene nameGene Name - the full gene name approved by the HGNC.
POU class 5 homeobox 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
POU5F1
SynonymsGene synonyms aliases
OCT3, OCT4, OCT4Borf1, OTF-3, OTF3, OTF4, Oct-3, Oct-4, Oct3/4
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT004904 hsa-miR-145-5p FACS, Flow, GFP reporter assay, In situ hybridization, Luciferase reporter assay, qRT-PCR 19409607
MIRT004904 hsa-miR-145-5p FACS, Flow, GFP reporter assay, In situ hybridization, Luciferase reporter assay, qRT-PCR 19409607
MIRT004904 hsa-miR-145-5p Immunofluorescence, qRT-PCR 22486352
MIRT004904 hsa-miR-145-5p Immunofluorescence, qRT-PCR 22486352
MIRT004904 hsa-miR-145-5p Immunofluorescence, qRT-PCR 22486352
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Transcription factor Regulation Reference
CEBPD Activation 15284209
DNMT3A Unknown 22867868
HDAC1 Unknown 22867868
MBD2 Unknown 22867868
NANOG Activation 22378194
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 19409607
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 19409607
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q01860
Protein name POU domain, class 5, transcription factor 1 (Octamer-binding protein 3) (Oct-3) (Octamer-binding protein 4) (Oct-4) (Octamer-binding transcription factor 3) (OTF-3)
Protein function Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Cri
PDB 6T90 , 6YOV , 7U0G , 7U0I , 8G87 , 8G88 , 8G8B , 8G8E , 8G8G , 8OTS , 8SPS , 8SPU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou
141 → 212
Pou domain - N-terminal to homeobox domain
 Domain
PF00046 Homeodomain
231 → 287
Homeodomain
 Domain
Sequence 
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG
AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS
QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Sequence length 360
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  Signaling pathways regulating pluripotency of stem cells   POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Transcriptional regulation of pluripotent stem cells
Associated diseases
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Neoplasm Neoplasms, Germ Cell and Embryonal, Neoplasms, Embryonal and Mixed rs137854562, rs137854565, rs137854568, rs137854574, rs121434220, rs121909218, rs121909222, rs587776667, rs606231169, rs587776701, rs121913388, rs137852578, rs137852216, rs121912651, rs28934575, rs28934571, rs121912654, rs11540652, rs28934573, rs28934576, rs28934578, rs121912667, rs104893810, rs121913530, rs121913301, rs79184941, rs121908595, rs11554290, rs121434596, rs121913364, rs121434592, rs121913502, rs11554273, rs121913495, rs121913479, rs121913412, rs121913407, rs80338964, rs377767360, rs387906650, rs121913272, rs63750393, rs587776935, rs121913250, rs121913237, rs397516436, rs121913343, rs397516439, rs397516981, rs121913240, rs121913529, rs121913428, rs121913465, rs397517199, rs397517201, rs45446594, rs45481400, rs80358042, rs146650273, rs63750087, rs398123117, rs201744589, rs587778833, rs587778867, rs587778850, rs587778825, rs587776783, rs587780070, rs587780071, rs587780073, rs587777476, rs587781255, rs587781288, rs587781392, rs587781558, rs80358870, rs587781694, rs587781807, rs587782018, rs587782206, rs121913344, rs587782529, rs587782664, rs587782682, rs587782705, rs121913500, rs121913291, rs587783697, rs587783690, rs587783502, rs193920774, rs724159946, rs730880472, rs564652222, rs730882029, rs730882005, rs730882025, rs730882019, rs869025192, rs768922431, rs786203485, rs786202918, rs398123329, rs786201059, rs121912657, rs786201090, rs786204910, rs786204853, rs121913293, rs121913332, rs797044942, rs121913333, rs863224491, rs863224451, rs863224499, rs760043106, rs863225332, rs864622636, rs864622451, rs779707422, rs879255270, rs875989848, rs876661244, rs876660754, rs746235533, rs876659384, rs587778720, rs483352697, rs876658694, rs121913331, rs55863639, rs786203650, rs879254171, rs80359365, rs886040960, rs886042002, rs886041779, rs1057516620, rs1057517302, rs1057517544, rs1057517992, rs1057518134, rs985033810, rs1057517840, rs587777613, rs147001633, rs377577594, rs121913499, rs121909224, rs1057519724, rs1057519729, rs121913503, rs1057519742, rs121913294, rs121913538, rs121913287, rs121913284, rs74535574, rs1057519757, rs397516790, rs121913285, rs121913387, rs121913236, rs1057519893, rs1057519906, rs1057519929, rs772110575, rs1057519941, rs786202962, rs764146326, rs1057519989, rs121912656, rs1057519992, rs866775781, rs1057519996, rs765848205, rs138729528, rs786201057, rs864622237, rs1057520672, rs1060500766, rs587781702, rs866380588, rs11540654, rs770776262, rs1057519984, rs121913321, rs1064793022, rs1064794276, rs112431538, rs1064794311, rs1064794618, rs1064796632, rs750318549, rs1554897889, rs1554900675, rs1114167568, rs587783031, rs1114167621, rs1114167629, rs1114167657, rs1131690863, rs11575996, rs1131691039, rs1131691026, rs1131690921, rs1131691082, rs863225313, rs1554085846, rs1553647989, rs1554898074, rs764735889, rs553257776, rs1554898067, rs1555615472, rs1060500352, rs1555526131, rs1057519990, rs1270783041, rs1019340046, rs1057523347, rs1553332772, rs1555525429, rs1060500345, rs1554730670, rs1555526469, rs11575997, rs1554069710, rs1555610903, rs1565400045, rs1565486028, rs1569061768, rs1114167577, rs1561588104, rs751448371, rs1564568473, rs1567556930, rs1567555934, rs1559587104, rs1569293373, rs1568498107, rs141798398, rs1597359215, rs757274881, rs1567556123, rs1555525367, rs1202793339, rs1568504941, rs1587330312, rs1060501207, rs1589596415, rs1595314951, rs1598173737, rs1597375294, rs1567555445, rs1595331264, rs1593060859, rs1859977029, rs1217977493, rs1961431691, rs2073243450, rs1724674149, rs1820531050 16168501
Congenital heart defects Congenital Heart Defects rs267607101, rs121434422, rs387906498, rs397509416, rs587777371, rs587777372, rs587777374, rs367537998, rs797044882, rs886041730, rs768027510, rs1064793873, rs1555447012, rs1554263268, rs1554263321, rs1555223294, rs782051102, rs1555896779, rs1555896778, rs1555897088, rs374016704, rs1555446983, rs1479104927, rs1562443558, rs755445139, rs1581616817, rs1581655293, rs1899172049 26507003
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261 17632545, 24509480, 28869590
Hydatidiform mole Gestational trophoblastic disease rs104895504, rs104895505, rs104895506, rs104895502, rs104895503, rs104895530, rs104895548, rs104895549, rs606231233, rs606231234, rs104895554, rs104895525, rs104895512, rs104895553, rs104895547, rs606231286, rs745776920, rs749779829, rs1569203272, rs759915989, rs2069070395, rs2068825510 18440631
Unknown
Disease name Disease term dbSNP ID References
Crohn disease Crohn Disease rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438 23266558
Embryonal neoplasm Embryonal Neoplasm 16168501
Tumor Germ cell tumor 16168501
Gestational trophoblastic neoplasms Gestational Trophoblastic Neoplasms 18440631

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412