UGT1A8 (UDP glucuronosyltransferase family 1 member A8)

Gene

• Entrez ID: 54576
• Gene name: UDP glucuronosyltransferase family 1 member A8
• Gene symbol: UGT1A8
• Synonyms: GNT1, UDPGT, UDPGT 1-1, UDPGT 1-8, UGT-1A, UGT-1H, UGT1, UGT1-01, UGT1-08, UGT1.1, UGT1.8, UGT1A, UGT1A1, UGT1A8S, UGT1H, hUG-BR1
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1473517	hsa-miR-1202	CLIP-seq
MIRT1473518	hsa-miR-136	CLIP-seq
MIRT1473519	hsa-miR-3120-5p	CLIP-seq
MIRT1473520	hsa-miR-3130-3p	CLIP-seq
MIRT1473521	hsa-miR-3194-5p	CLIP-seq
MIRT1473522	hsa-miR-346	CLIP-seq
MIRT1473523	hsa-miR-3909	CLIP-seq
MIRT1473524	hsa-miR-3940-5p	CLIP-seq
MIRT1473525	hsa-miR-3972	CLIP-seq
MIRT1473526	hsa-miR-4288	CLIP-seq
MIRT1473527	hsa-miR-4421	CLIP-seq
MIRT1473528	hsa-miR-4507	CLIP-seq
MIRT1473529	hsa-miR-4766-5p	CLIP-seq
MIRT1473530	hsa-miR-4793-3p	CLIP-seq
MIRT1473531	hsa-miR-489	CLIP-seq
MIRT1473532	hsa-miR-514	CLIP-seq
MIRT1473533	hsa-miR-514b-3p	CLIP-seq
MIRT1473534	hsa-miR-548a-5p	CLIP-seq
MIRT1473535	hsa-miR-548ab	CLIP-seq
MIRT1473536	hsa-miR-548ak	CLIP-seq
MIRT1473537	hsa-miR-548b-5p	CLIP-seq
MIRT1473538	hsa-miR-548c-5p	CLIP-seq
MIRT1473539	hsa-miR-548d-5p	CLIP-seq
MIRT1473540	hsa-miR-548h	CLIP-seq
MIRT1473541	hsa-miR-548i	CLIP-seq
MIRT1473542	hsa-miR-548j	CLIP-seq
MIRT1473543	hsa-miR-548n	CLIP-seq
MIRT1473544	hsa-miR-548w	CLIP-seq
MIRT1473545	hsa-miR-548y	CLIP-seq
MIRT1473546	hsa-miR-559	CLIP-seq
MIRT1473547	hsa-miR-629	CLIP-seq
MIRT1473548	hsa-miR-632	CLIP-seq
MIRT2142606	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	15044625
HNF1A	Activation	15044625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IC	20308471
GO:0004857	Function	Enzyme inhibitor activity	IDA	19996319
GO:0005496	Function	Steroid binding	IDA	19996319
GO:0005504	Function	Fatty acid binding	IDA	19996319
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006631	Process	Fatty acid metabolic process	IC	19996319
GO:0008202	Process	Steroid metabolic process	IC	19996319
GO:0008202	Process	Steroid metabolic process	IDA	15472229, 16595710, 23288867
GO:0009804	Process	Coumarin metabolic process	IC	19996319
GO:0015020	Function	Glucuronosyltransferase activity	IDA	18052087, 19996319, 20056724, 20308471
GO:0016021	Component	Integral component of membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IC	19996319
GO:0045939	Process	Negative regulation of steroid metabolic process	IC	19996319
GO:0051552	Process	Flavone metabolic process	IDA	18052087
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052696	Process	Flavonoid glucuronidation	IDA	20056724
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IDA	20056724

Other IDs

• MIM: 606433
• HGNC: 12540
• e!Ensembl: ENSG00000242366

Protein

• UniProt ID: Q9HAW9
• Protein name: UDP-glucuronosyltransferase 1A8 (UGT1A8) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-8) (UDPGT 1-8) (UGT1*8) (UGT1-08) (UGT1.8) (UDP-glucuronosyltransferase 1-H) (UGT-1H) (UGT1H)
• Protein function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

• Sequence:

  MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
  EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLF
  FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEG
  AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVT
  AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
  PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
  ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
  YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

• Sequence length: 530

Pathways

KEGG:

Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Reactome:

Glucuronidation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541, rs797046091, rs748219743, rs72551340, rs1553620849, rs766536479, rs72551343, rs139607673	15712364, 26697581, 11182932
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	25246029

Unknown
Disease name	Disease term	dbSNP ID	References
Urinary bladder cancer	Malignant neoplasm of urinary bladder		20972438, 24163127
Bladder carcinoma	Carcinoma of bladder		24163127, 20972438