GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

POLR2J (RNA polymerase II subunit J)

Gene

5439

RNA polymerase II subunit J

POLR2J

POLR2J1, RPB11, RPB11A, RPB11m, hRPB14

7q22.1

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the

Show/Hide all(122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022854	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT1248910	hsa-miR-1197	CLIP-seq
MIRT1248911	hsa-miR-1273e	CLIP-seq
MIRT1248912	hsa-miR-1304	CLIP-seq
MIRT1248913	hsa-miR-219-1-3p	CLIP-seq
MIRT1248914	hsa-miR-224	CLIP-seq
MIRT1248915	hsa-miR-2278	CLIP-seq
MIRT1248916	hsa-miR-2467-5p	CLIP-seq
MIRT1248917	hsa-miR-3163	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248919	hsa-miR-3188	CLIP-seq
MIRT1248920	hsa-miR-3649	CLIP-seq
MIRT1248921	hsa-miR-3652	CLIP-seq
MIRT1248922	hsa-miR-3689a-3p	CLIP-seq
MIRT1248923	hsa-miR-3689c	CLIP-seq
MIRT1248924	hsa-miR-3975	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT1248927	hsa-miR-4327	CLIP-seq
MIRT1248928	hsa-miR-4430	CLIP-seq
MIRT1248929	hsa-miR-4433	CLIP-seq
MIRT1248930	hsa-miR-4436a	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT1248933	hsa-miR-4505	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT1248937	hsa-miR-4700-3p	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248939	hsa-miR-4710	CLIP-seq
MIRT1248940	hsa-miR-4777-5p	CLIP-seq
MIRT1248941	hsa-miR-485-5p	CLIP-seq
MIRT1248942	hsa-miR-518d-5p	CLIP-seq
MIRT1248943	hsa-miR-519b-5p	CLIP-seq
MIRT1248944	hsa-miR-519c-5p	CLIP-seq
MIRT1248945	hsa-miR-520c-5p	CLIP-seq
MIRT1248946	hsa-miR-526a	CLIP-seq
MIRT1248947	hsa-miR-548aa	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT1248950	hsa-miR-635	CLIP-seq
MIRT1248951	hsa-miR-665	CLIP-seq
MIRT1248952	hsa-miR-767-3p	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248954	hsa-miR-940	CLIP-seq
MIRT2073500	hsa-miR-1263	CLIP-seq
MIRT1248912	hsa-miR-1304	CLIP-seq
MIRT1248913	hsa-miR-219-1-3p	CLIP-seq
MIRT1248915	hsa-miR-2278	CLIP-seq
MIRT1248916	hsa-miR-2467-5p	CLIP-seq
MIRT1248919	hsa-miR-3188	CLIP-seq
MIRT2073501	hsa-miR-3670	CLIP-seq
MIRT1248922	hsa-miR-3689a-3p	CLIP-seq
MIRT1248923	hsa-miR-3689c	CLIP-seq
MIRT1248924	hsa-miR-3975	CLIP-seq
MIRT2073502	hsa-miR-4254	CLIP-seq
MIRT2073503	hsa-miR-4269	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT1248929	hsa-miR-4433	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT2073504	hsa-miR-4536	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT2073505	hsa-miR-4742-5p	CLIP-seq
MIRT1248940	hsa-miR-4777-5p	CLIP-seq
MIRT1248941	hsa-miR-485-5p	CLIP-seq
MIRT2073506	hsa-miR-507	CLIP-seq
MIRT1248942	hsa-miR-518d-5p	CLIP-seq
MIRT1248943	hsa-miR-519b-5p	CLIP-seq
MIRT1248944	hsa-miR-519c-5p	CLIP-seq
MIRT1248945	hsa-miR-520c-5p	CLIP-seq
MIRT1248946	hsa-miR-526a	CLIP-seq
MIRT2073507	hsa-miR-557	CLIP-seq
MIRT2073508	hsa-miR-619	CLIP-seq
MIRT2073509	hsa-miR-629	CLIP-seq
MIRT1248950	hsa-miR-635	CLIP-seq
MIRT2073510	hsa-miR-658	CLIP-seq
MIRT1248951	hsa-miR-665	CLIP-seq
MIRT1248952	hsa-miR-767-3p	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT2300504	hsa-miR-3914	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT2073502	hsa-miR-4254	CLIP-seq
MIRT2073503	hsa-miR-4269	CLIP-seq
MIRT2300505	hsa-miR-4283	CLIP-seq
MIRT2300506	hsa-miR-4284	CLIP-seq
MIRT2300507	hsa-miR-4437	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248932	hsa-miR-4468	CLIP-seq
MIRT2300508	hsa-miR-4508	CLIP-seq
MIRT1248934	hsa-miR-4514	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248936	hsa-miR-4692	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248939	hsa-miR-4710	CLIP-seq
MIRT2073505	hsa-miR-4742-5p	CLIP-seq
MIRT2300509	hsa-miR-513a-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT2073510	hsa-miR-658	CLIP-seq
MIRT2073501	hsa-miR-3670	CLIP-seq
MIRT1248926	hsa-miR-4300	CLIP-seq
MIRT2073506	hsa-miR-507	CLIP-seq
MIRT2073507	hsa-miR-557	CLIP-seq
MIRT2073509	hsa-miR-629	CLIP-seq
MIRT1248953	hsa-miR-920	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq
MIRT1248918	hsa-miR-3184	CLIP-seq
MIRT1248925	hsa-miR-423-5p	CLIP-seq
MIRT1248931	hsa-miR-4457	CLIP-seq
MIRT1248935	hsa-miR-4651	CLIP-seq
MIRT1248938	hsa-miR-4701-5p	CLIP-seq
MIRT1248948	hsa-miR-588	CLIP-seq
MIRT1248949	hsa-miR-608	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0001055	Function	RNA polymerase II activity	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed 5'-3' RNA polymerase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10783144, 21988832, 25416956, 32296183
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA	21873635
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006351	Process	Transcription, DNA-templated	TAS
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006368	Process	Transcription elongation from RNA polymerase II promoter	TAS
GO:0006370	Process	7-methylguanosine mRNA capping	TAS
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0016070	Process	RNA metabolic process	TAS
GO:0030275	Function	LRR domain binding	IPI	10783144
GO:0035019	Process	Somatic stem cell population maintenance	TAS
GO:0042795	Process	SnRNA transcription by RNA polymerase II	TAS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050434	Process	Positive regulation of viral transcription	TAS
GO:0060964	Process	Regulation of gene silencing by miRNA	TAS

MIM	HGNC	e!Ensembl
604150	9197	ENSG00000005075

Protein

UniProt ID

P52435

Protein name

DNA-directed RNA polymerase II subunit RPB11-a (RNA polymerase II subunit B11-a) (RPB11a) (DNA-directed RNA polymerase II subunit J-1) (RNA polymerase II 13.3 kDa subunit)

Protein function

Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates. {ECO:0000269|PubMed:27193682, ECO:00002

PDB

5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7LBM , 9EHZ , 9EI1 , 9EI3 , 9EI4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13656	RNA_pol_L_2	30 → 104	RNA polymerase Rpb3/Rpb11 dimerisation domain	Domain

Sequence

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence length

117

Interactions

View interactions

	KEGG		Reactome
	RNA polymerase Nucleotide excision repair Huntington disease		Formation of RNA Pol II elongation complex Formation of the Early Elongation Complex Formation of HIV-1 elongation complex containing HIV-1 Tat Viral Messenger RNA Synthesis MicroRNA (miRNA) biogenesis Transcriptional regulation by small RNAs RNA Polymerase II Pre-transcription Events Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER TP53 Regulates Transcription of DNA Repair Genes FGFR2 alternative splicing RNA polymerase II transcribes snRNA genes mRNA Capping mRNA Splicing - Major Pathway mRNA Splicing - Minor Pathway Processing of Capped Intron-Containing Pre-mRNA RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Elongation RNA Polymerase II Transcription Initiation And Promoter Clearance RNA Pol II CTD phosphorylation and interaction with CE Estrogen-dependent gene expression

Associated diseases

Show/Hide Causal Diseases (1)

Causal
Disease name	Disease term	dbSNP ID	References
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	29059683

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412