PML (PML nuclear body scaffold)

Gene

• Entrez ID: 5371
• Gene name: PML nuclear body scaffold
• Gene symbol: PML
• Synonyms: MYL, PP8675, RNF71, TRIM19
• Chromosome: 15
• Chromosome location: 15q24.1
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies wh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018318	hsa-miR-335-5p	Microarray	18185580
MIRT043919	hsa-miR-378a-3p	CLASH	23622248
MIRT042535	hsa-miR-423-3p	CLASH	23622248
MIRT042535	hsa-miR-423-3p	CLASH	23622248
MIRT1244408	hsa-miR-1227	CLIP-seq
MIRT1244409	hsa-miR-124	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT1244410	hsa-miR-1321	CLIP-seq
MIRT1244411	hsa-miR-2113	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT1244412	hsa-miR-3065-5p	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT1244413	hsa-miR-3156-5p	CLIP-seq
MIRT1244414	hsa-miR-3173-3p	CLIP-seq
MIRT1244415	hsa-miR-3180-5p	CLIP-seq
MIRT1244416	hsa-miR-3194-3p	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT1244418	hsa-miR-3920	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT1244419	hsa-miR-4325	CLIP-seq
MIRT1244420	hsa-miR-4419a	CLIP-seq
MIRT1244421	hsa-miR-4510	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT1244423	hsa-miR-4536	CLIP-seq
MIRT1244424	hsa-miR-455-5p	CLIP-seq
MIRT1244425	hsa-miR-4688	CLIP-seq
MIRT1244426	hsa-miR-4739	CLIP-seq
MIRT1244427	hsa-miR-4756-5p	CLIP-seq
MIRT1244428	hsa-miR-4762-3p	CLIP-seq
MIRT1244429	hsa-miR-4779	CLIP-seq
MIRT1244430	hsa-miR-486-3p	CLIP-seq
MIRT1244431	hsa-miR-506	CLIP-seq
MIRT1244432	hsa-miR-513a-3p	CLIP-seq
MIRT1244433	hsa-miR-520a-5p	CLIP-seq
MIRT1244434	hsa-miR-525-5p	CLIP-seq
MIRT1244435	hsa-miR-569	CLIP-seq
MIRT1244436	hsa-miR-659	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT2072199	hsa-miR-4313	CLIP-seq
MIRT2072200	hsa-miR-4492	CLIP-seq
MIRT2072201	hsa-miR-4498	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2072203	hsa-miR-4667-3p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2072205	hsa-miR-4675	CLIP-seq
MIRT2072206	hsa-miR-4685-5p	CLIP-seq
MIRT2072207	hsa-miR-4741	CLIP-seq
MIRT2072208	hsa-miR-4742-5p	CLIP-seq
MIRT2072209	hsa-miR-4776-3p	CLIP-seq
MIRT2072210	hsa-miR-762	CLIP-seq
MIRT2299469	hsa-miR-1293	CLIP-seq
MIRT2299470	hsa-miR-1298	CLIP-seq
MIRT2299471	hsa-miR-323-5p	CLIP-seq
MIRT2299472	hsa-miR-342-5p	CLIP-seq
MIRT2299473	hsa-miR-3689a-3p	CLIP-seq
MIRT2299474	hsa-miR-3689c	CLIP-seq
MIRT2299475	hsa-miR-4446-3p	CLIP-seq
MIRT2299476	hsa-miR-4483	CLIP-seq
MIRT2072200	hsa-miR-4492	CLIP-seq
MIRT2072201	hsa-miR-4498	CLIP-seq
MIRT2299477	hsa-miR-4505	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2299478	hsa-miR-4651	CLIP-seq
MIRT2299479	hsa-miR-4664-5p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2299480	hsa-miR-4721	CLIP-seq
MIRT2299481	hsa-miR-4728-5p	CLIP-seq
MIRT2299482	hsa-miR-4731-5p	CLIP-seq
MIRT2299483	hsa-miR-608	CLIP-seq
MIRT2299484	hsa-miR-664	CLIP-seq
MIRT2072210	hsa-miR-762	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT2072199	hsa-miR-4313	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2072203	hsa-miR-4667-3p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2072208	hsa-miR-4742-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT2596116	hsa-miR-1914	CLIP-seq
MIRT2596117	hsa-miR-2114	CLIP-seq
MIRT2596118	hsa-miR-339-5p	CLIP-seq
MIRT2596119	hsa-miR-4676-5p	CLIP-seq
MIRT2596120	hsa-miR-575	CLIP-seq
MIRT2688245	hsa-miR-1	CLIP-seq
MIRT2688246	hsa-miR-1253	CLIP-seq
MIRT2688247	hsa-miR-1255a	CLIP-seq
MIRT2688248	hsa-miR-1255b	CLIP-seq
MIRT2688249	hsa-miR-1264	CLIP-seq
MIRT2688250	hsa-miR-132	CLIP-seq
MIRT2688251	hsa-miR-206	CLIP-seq
MIRT2688252	hsa-miR-212	CLIP-seq
MIRT2688253	hsa-miR-3673	CLIP-seq
MIRT2688254	hsa-miR-4300	CLIP-seq
MIRT2688255	hsa-miR-4633-3p	CLIP-seq
MIRT2688256	hsa-miR-613	CLIP-seq
MIRT2688257	hsa-miR-920	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARID3A	Activation	22010578
IRF9	Activation	8681971
PML	Activation	15529177
STAT1	Activation	21115099;22589541
STAT1	Unknown	15519999
STAT2	Unknown	17062732
TP53	Activation	14992722

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000781	Component	Chromosome, telomeric region	IDA	26119943
GO:0000785	Component	Chromatin	IBA	21873635
GO:0000792	Component	Heterochromatin	IEA
GO:0001666	Process	Response to hypoxia	IDA	16915281
GO:0001932	Process	Regulation of protein phosphorylation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9294197, 10669754, 10684855, 11259576, 11948183, 12006491, 12529400, 12915590, 14517282, 14976184, 15195100, 15467728, 15626733, 16322229, 16873060, 16915281, 17036045, 18298799, 18511908, 20389280, 20625391, 20639899, 20832753, 21057547, 21803845, 21840486, 21988832, 21994459, 2200
GO:0005634	Component	Nucleus	IDA	9412458, 22274616
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA	12915590
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	15195100
GO:0005737	Component	Cytoplasm	IDA	18298799
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	23007646
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	ISS
GO:0007050	Process	Cell cycle arrest	IBA	21873635
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007182	Process	Common-partner SMAD protein phosphorylation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	12006491
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009411	Process	Response to UV	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010522	Process	Regulation of calcium ion transport into cytosol	ISS
GO:0010761	Process	Fibroblast migration	IEA
GO:0016032	Process	Viral process	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	16915281
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016605	Component	PML body	IBA	21873635
GO:0016605	Component	PML body	IDA	9412458, 9448006, 11331580, 12917339, 15195100, 17081985, 22155184, 22869143, 23007646, 23431171
GO:0016605	Component	PML body	IDA	10910364
GO:0016605	Component	PML body	TAS	9230084
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	9448006
GO:0030578	Process	PML body organization	IBA	21873635
GO:0030578	Process	PML body organization	IMP	17081985
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12915590
GO:0031901	Component	Early endosome membrane	IEA
GO:0032183	Function	SUMO binding	IPI	17081985
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	26119943
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034097	Process	Response to cytokine	IDA	9412458
GO:0042406	Component	Extrinsic component of endoplasmic reticulum membrane	ISS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	ISS
GO:0042803	Function	Protein homodimerization activity	IPI	9230084
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	22406621
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045165	Process	Cell fate commitment	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	9448006
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IBA	21873635
GO:0046332	Function	SMAD binding	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0051457	Process	Maintenance of protein location in nucleus	IDA	17332504
GO:0051607	Process	Defense response to virus	IEA
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	12915590
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0090398	Process	Cellular senescence	IDA	22002537, 22117195, 23431171
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0140037	Function	Sumo-dependent protein binding	IPI	17081986
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902187	Process	Negative regulation of viral release from host cell	IDA	18248090
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IMP	15195100
GO:2000779	Process	Regulation of double-strand break repair	IMP	21639834
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21803845

Other IDs

• MIM: 102578
• HGNC: 9113
• e!Ensembl: ENSG00000140464

Protein

• UniProt ID: P29590
• Protein name: Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)
• Protein function: Functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms. A
• PDB: 1BOR, 2MVW, 2MWX, 4WJN, 4WJO, 5YUF, 6IMQ, 6UYO, 6UYP, 6UYQ, 6UYR, 6UYS, 6UYT, 6UYU, 6UYV, 8DJH, 8DJI, 8J25, 8J2P, 8YTC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00643	zf-B_box	124 → 166	B-box zinc finger	Domain
  PF12126	DUF3583	240 → 570	Protein of unknown function (DUF3583)	Family

• Sequence:

  MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
  QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
  QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
  TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
  DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
  VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
  QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
  EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
  QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
  NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
  ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
  HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
  ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
  LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
  FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS

• Sequence length: 882

Pathways

KEGG:

Ubiquitin mediated proteolysis
Endocytosis
Influenza A
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia

Reactome:

SUMOylation of DNA damage response and repair proteins
SUMOylation of ubiquitinylation proteins
Regulation of TP53 Activity through Acetylation
Interferon gamma signaling
Regulation of RUNX1 Expression and Activity
Regulation of PTEN localization
HCMV Early Events
Transcriptional regulation of granulopoiesis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Exfoliation syndrome	Exfoliation Syndrome	rs1048661, rs2165241	24938310
Glioblastoma	Glioblastoma, Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888	23440206
Hypofibrinogenemia	Hypofibrinogenemia	rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	21211798
Myopia	Myopia, Degenerative	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805, rs782555528, rs1554862601, rs1586620121, rs1387950081, rs2051026773, rs1422332023	23049088
Neutropenia	Neutropenia	rs879253882
Paget disease	Osteitis Deformans, Paget Disease	rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582	21623375
Pancytopenia	Pancytopenia	rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29335545
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21822266

Unknown
Disease name	Disease term	dbSNP ID	References
Anorexia	Anorexia
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage
Disseminated intravascular coagulation	Disseminated Intravascular Coagulation
Fibrinogen deficiency	Fibrinogen Deficiency
Gangrene	Gangrene
Giant cell glioblastoma	Giant Cell Glioblastoma		23440206
Leukopenia	Leukopenia
Promyelocytic leukemia	Acute Promyelocytic Leukemia		19887701, 16935935, 23208507, 10742073, 16788101, 16835227, 10942371, 19029980, 17649720, 21613260, 19035177, 22213200, 14706140, 16891316, 21345080, 26285909, 17294898, 8616088, 19884644, 23734343, 26728337
Prostatic neoplasms	Prostatic Neoplasms		29335545
Stevens-johnson syndrome	Toxic Epidermal Necrolysis, Stevens-Johnson Syndrome, Drug-Induced Stevens Johnson Syndrome, Mycoplasma-Induced Stevens-Johnson Syndrome, Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum		25811541
Stomatitis	Stomatitis
Treatment related secondary malignancy	Treatment related secondary malignancy		19884644