PLK1 (polo like kinase 1)

Gene

• Entrez ID: 5347
• Gene name: Polo like kinase 1
• Gene symbol: PLK1
• Synonyms: PLK, STPK13
• Chromosome: 16
• Chromosome location: 16p12.2
• Summary: The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001430	hsa-miR-16-5p	pSILAC	18668040
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR	19739117
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT006042	hsa-miR-593-5p	Luciferase reporter assay, qRT-PCR, Western blot	21170987
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	22120675
MIRT000382	hsa-miR-100-5p	Immunoblot, Immunohistochemistry, qRT-PCR, Western blot	21636267
MIRT020615	hsa-miR-155-5p	Proteomics	18668040
MIRT001430	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT051975	hsa-let-7b-5p	CLASH	23622248
MIRT038920	hsa-miR-92a-1-5p	CLASH	23622248
MIRT037761	hsa-miR-874-3p	CLASH	23622248
MIRT037217	hsa-miR-877-5p	CLASH	23622248
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	23151088
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT000382	hsa-miR-100-5p	Luciferase reporter assay, Western blot	23842624
MIRT053537	hsa-miR-10b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23125021
MIRT000382	hsa-miR-100-5p	Western blot	22249248
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	Luciferase reporter assay, Western blot	26549165
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT732109	hsa-miR-296-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT006042	hsa-miR-593-5p	PAR-CLIP	26701625
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT194895	hsa-miR-1224-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33976745
MIRT733426	hsa-miR-122-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32700753
MIRT194901	hsa-miR-3120-3p	PAR-CLIP	23446348
MIRT504618	hsa-miR-1322	PAR-CLIP	23446348
MIRT194895	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT194900	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT504617	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT504616	hsa-miR-4660	PAR-CLIP	23446348
MIRT504615	hsa-miR-1301-3p	PAR-CLIP	23446348
MIRT504614	hsa-miR-5047	PAR-CLIP	23446348
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2071781	hsa-miR-1203	CLIP-seq
MIRT2071782	hsa-miR-1913	CLIP-seq
MIRT2071783	hsa-miR-3194-3p	CLIP-seq
MIRT2071784	hsa-miR-324-3p	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071790	hsa-miR-4691-3p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq
MIRT2298932	hsa-miR-183	CLIP-seq
MIRT2298933	hsa-miR-2276	CLIP-seq
MIRT2298934	hsa-miR-3158-5p	CLIP-seq
MIRT2298935	hsa-miR-3166	CLIP-seq
MIRT2298936	hsa-miR-4418	CLIP-seq
MIRT2071785	hsa-miR-4492	CLIP-seq
MIRT2071786	hsa-miR-4498	CLIP-seq
MIRT2071787	hsa-miR-4505	CLIP-seq
MIRT2071788	hsa-miR-4508	CLIP-seq
MIRT2071789	hsa-miR-4655-5p	CLIP-seq
MIRT2071791	hsa-miR-4731-5p	CLIP-seq
MIRT2298937	hsa-miR-4771	CLIP-seq
MIRT1242886	hsa-miR-4778-5p	CLIP-seq
MIRT2298938	hsa-miR-4789-5p	CLIP-seq
MIRT2298939	hsa-miR-509-5p	CLIP-seq
MIRT2298940	hsa-miR-541	CLIP-seq
MIRT2071792	hsa-miR-637	CLIP-seq
MIRT2298941	hsa-miR-654-5p	CLIP-seq
MIRT2071793	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	24076372
E2F3	Unknown	16909110
E2F4	Repression	17981789
TP53	Unknown	24076372

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	23455478
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18174154
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	23509069
GO:0000278	Process	Mitotic cell cycle	IBA	21873635
GO:0000278	Process	Mitotic cell cycle	IDA	18615013
GO:0000278	Process	Mitotic cell cycle	IMP	18477460
GO:0000281	Process	Mitotic cytokinesis	IDA	19468302
GO:0000287	Function	Magnesium ion binding	IMP	17461553
GO:0000776	Component	Kinetochore	IDA	17617734, 18477460, 18615013, 21041660, 23455478, 24157919, 25395579
GO:0000785	Component	Chromatin	IEA
GO:0000795	Component	Synaptonemal complex	IEA
GO:0000922	Component	Spindle pole	IBA	21873635
GO:0000922	Component	Spindle pole	IDA	18331714, 21041660
GO:0000942	Component	Condensed nuclear chromosome outer kinetochore	IDA	18195732
GO:0001578	Process	Microtubule bundle formation	IDA	12939256
GO:0004672	Function	Protein kinase activity	IDA	17146433, 19596235, 22854038
GO:0004672	Function	Protein kinase activity	IMP	17461553
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	18378770, 20577264
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12524548, 12939256, 15148369, 17351640, 18174154, 18477460, 19160488, 19468300, 19468302, 23509069
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	19473992, 21041660, 23455478
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12493754, 12524548, 12939256, 15148369, 15654075, 16439210, 16753148, 16760428, 16815967, 16864798, 16980960, 17146433, 17307877, 17310276, 17351640, 17495026, 18174154, 18250300, 18329369, 18331714, 18477460, 18521620, 18615013, 18794143, 19160488, 19468300, 19468302, 19473992, 195
GO:0005524	Function	ATP binding	IMP	17461553
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	18615013
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	8991084, 12524548, 18477460, 18615013, 21041660, 21399614, 23455478, 24157919, 27579920
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IDA	12939256, 17351640
GO:0005829	Component	Cytosol	TAS
GO:0005876	Component	Spindle microtubule	IDA	21041660
GO:0006468	Process	Protein phosphorylation	IDA	19468300, 20679239, 22701722, 23509069
GO:0006468	Process	Protein phosphorylation	IMP	17461553
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007062	Process	Sister chromatid cohesion	TAS
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007094	Process	Mitotic spindle assembly checkpoint	IMP	23455478
GO:0007098	Process	Centrosome cycle	IMP	8991084, 18477460
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	17495026
GO:0008017	Function	Microtubule binding	IDA	12939256
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	21041660
GO:0010997	Function	Anaphase-promoting complex binding	IPI	18662541
GO:0015630	Component	Microtubule cytoskeleton	IDA	21041660
GO:0016301	Function	Kinase activity	TAS
GO:0016321	Process	Female meiosis chromosome segregation	IEA
GO:0016567	Process	Protein ubiquitination	IDA	16885022
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16885022
GO:0019901	Function	Protein kinase binding	IPI	12639966, 18615013, 21041660
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IDA	23509069
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IMP	21041660
GO:0030496	Component	Midbody	IDA	19468300
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031648	Process	Protein destabilization	IDA	16885022
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	19473992
GO:0032465	Process	Regulation of cytokinesis	IBA	21873635
GO:0032465	Process	Regulation of cytokinesis	IDA	17351640
GO:0032465	Process	Regulation of cytokinesis	IMP	12939256
GO:0034451	Component	Centriolar satellite	IEA
GO:0042802	Function	Identical protein binding	IPI	21041660, 23354166, 26192437
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18174154
GO:0043393	Process	Regulation of protein binding	IMP	21041660
GO:0045143	Process	Homologous chromosome segregation	IEA
GO:0045184	Process	Establishment of protein localization	IMP	18331714
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	21041660
GO:0045862	Process	Positive regulation of proteolysis	IDA	16885022
GO:0051081	Process	Nuclear envelope disassembly	IMP	20679239
GO:0051233	Component	Spindle midzone	IDA	19468302, 21041660
GO:0051443	Process	Positive regulation of ubiquitin-protein transferase activity	IMP	19473992
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0070194	Process	Synaptonemal complex disassembly	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	21111234
GO:0072425	Process	Signal transduction involved in G2 DNA damage checkpoint	IDA	18662541
GO:0090435	Process	Protein localization to nuclear envelope	IMP	20679239
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:1900182	Process	Positive regulation of protein localization to nucleus	TAS
GO:1901673	Process	Regulation of mitotic spindle assembly	IDA	22621898
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	TAS
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	IDA	15148369
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	TAS
GO:1904776	Process	Regulation of protein localization to cell cortex	IDA	23509069

Other IDs

• MIM: 602098
• HGNC: 9077
• e!Ensembl: ENSG00000166851

Protein

• UniProt ID: P53350
• Protein name: Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13)
• Protein function: Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivatio
• PDB: 1Q4K, 1Q4O, 1UMW, 2OGQ, 2OJX, 2OU7, 2OWB, 2RKU, 2V5Q, 2YAC, 3BZI, 3C5L, 3FC2, 3FVH, 3HIH, 3HIK, 3KB7, 3P2W, 3P2Z, 3P34, 3P35, 3P36, 3P37, 3Q1I, 3RQ7, 3THB, 4A4L, 4A4O, 4DFW, 4E67, 4E9C, 4E9D, 4H5X, 4H71, 4HAB, 4HCO, 4HY2, 4J52, 4J53, 4LKL, 4LKM, 4O56, 4O6W, 4O9W, 4RCP, 4WHH, 4WHK, 4WHL, 4X9R, 4X9V, 4X9W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	53 → 305	Protein kinase domain	Domain
  PF00659	POLO_box	418 → 479	POLO box duplicated region	Family
  PF00659	POLO_box	516 → 583	POLO box duplicated region	Family

• Sequence:

  MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
  KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
  EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
  NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
  MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
  NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
  PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
  YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
  YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
  LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
  KAS

• Sequence length: 603

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Polo-like kinase mediated events
Golgi Cisternae Pericentriolar Stack Reorganization
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Phosphorylation of the APC/C
Phosphorylation of Emi1
Condensation of Prophase Chromosomes
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
RHO GTPases Activate Formins
Mitotic Prometaphase
Mitotic Metaphase/Anaphase Transition
Mitotic Telophase/Cytokinesis
Cyclin A/B1/B2 associated events during G2/M transition
The role of GTSE1 in G2/M progression after G2 checkpoint
AURKA Activation by TPX2
EML4 and NUDC in mitotic spindle formation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701	22000864
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	26008977
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560