PLAUR (plasminogen activator, urokinase receptor)

Gene

• Entrez ID: 5329
• Gene name: Plasminogen activator, urokinase receptor
• Gene symbol: PLAUR
• Synonyms: CD87, U-PAR, UPAR, URKR
• Chromosome: 19
• Chromosome location: 19q13.31
• Summary: This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized deg

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005839	hsa-miR-204-5p	Microarray	21282569
MIRT020661	hsa-miR-155-5p	Proteomics	18668040
MIRT031606	hsa-miR-16-5p	Proteomics	18668040
MIRT1239464	hsa-miR-1200	CLIP-seq
MIRT1239465	hsa-miR-1208	CLIP-seq
MIRT1239466	hsa-miR-3074-3p	CLIP-seq
MIRT1239467	hsa-miR-335	CLIP-seq
MIRT1239468	hsa-miR-3545-3p	CLIP-seq
MIRT1239469	hsa-miR-3670	CLIP-seq
MIRT1239470	hsa-miR-3929	CLIP-seq
MIRT1239471	hsa-miR-4324	CLIP-seq
MIRT1239472	hsa-miR-4419b	CLIP-seq
MIRT1239473	hsa-miR-4423-5p	CLIP-seq
MIRT1239474	hsa-miR-4478	CLIP-seq
MIRT1239475	hsa-miR-4635	CLIP-seq
MIRT1239476	hsa-miR-4659a-3p	CLIP-seq
MIRT1239477	hsa-miR-4659b-3p	CLIP-seq
MIRT1239478	hsa-miR-4680-5p	CLIP-seq
MIRT1239479	hsa-miR-4684-5p	CLIP-seq
MIRT1239480	hsa-miR-544b	CLIP-seq
MIRT1239481	hsa-miR-892a	CLIP-seq
MIRT1239482	hsa-miR-942	CLIP-seq
MIRT2070427	hsa-miR-103b	CLIP-seq
MIRT2070428	hsa-miR-1236	CLIP-seq
MIRT2070429	hsa-miR-127-3p	CLIP-seq
MIRT2070430	hsa-miR-3167	CLIP-seq
MIRT2070431	hsa-miR-3202	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2070433	hsa-miR-3936	CLIP-seq
MIRT2070434	hsa-miR-4436b-3p	CLIP-seq
MIRT2070435	hsa-miR-4450	CLIP-seq
MIRT2070436	hsa-miR-4525	CLIP-seq
MIRT2070437	hsa-miR-4685-5p	CLIP-seq
MIRT2070438	hsa-miR-4716-3p	CLIP-seq
MIRT2070439	hsa-miR-4747-5p	CLIP-seq
MIRT2070440	hsa-miR-4753-3p	CLIP-seq
MIRT2070441	hsa-miR-4768-5p	CLIP-seq
MIRT2070442	hsa-miR-615-5p	CLIP-seq
MIRT2070443	hsa-miR-876-5p	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2392613	hsa-miR-3137	CLIP-seq
MIRT2392614	hsa-miR-3158-3p	CLIP-seq
MIRT2392615	hsa-miR-3192	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2392616	hsa-miR-4300	CLIP-seq
MIRT2392617	hsa-miR-4446-3p	CLIP-seq
MIRT2392618	hsa-miR-4492	CLIP-seq
MIRT2392619	hsa-miR-4498	CLIP-seq
MIRT2392620	hsa-miR-4505	CLIP-seq
MIRT2392621	hsa-miR-4537	CLIP-seq
MIRT2392622	hsa-miR-762	CLIP-seq
MIRT2392623	hsa-miR-920	CLIP-seq
MIRT2070427	hsa-miR-103b	CLIP-seq
MIRT2070428	hsa-miR-1236	CLIP-seq
MIRT2439517	hsa-miR-193a-3p	CLIP-seq
MIRT2439518	hsa-miR-193b	CLIP-seq
MIRT2439519	hsa-miR-3120-3p	CLIP-seq
MIRT2392613	hsa-miR-3137	CLIP-seq
MIRT2439520	hsa-miR-3153	CLIP-seq
MIRT2392614	hsa-miR-3158-3p	CLIP-seq
MIRT2439521	hsa-miR-3176	CLIP-seq
MIRT2439522	hsa-miR-3182	CLIP-seq
MIRT2439523	hsa-miR-376a	CLIP-seq
MIRT2439524	hsa-miR-376b	CLIP-seq
MIRT2070432	hsa-miR-377	CLIP-seq
MIRT2439525	hsa-miR-3922-3p	CLIP-seq
MIRT2439526	hsa-miR-3977	CLIP-seq
MIRT2392617	hsa-miR-4446-3p	CLIP-seq
MIRT2439527	hsa-miR-4646-5p	CLIP-seq
MIRT2439528	hsa-miR-4649-3p	CLIP-seq
MIRT2439529	hsa-miR-4668-5p	CLIP-seq
MIRT2070440	hsa-miR-4753-3p	CLIP-seq
MIRT2070441	hsa-miR-4768-5p	CLIP-seq
MIRT1239480	hsa-miR-544b	CLIP-seq
MIRT2439530	hsa-miR-548a-3p	CLIP-seq
MIRT2439531	hsa-miR-548e	CLIP-seq
MIRT2439532	hsa-miR-548f	CLIP-seq
MIRT2439533	hsa-miR-758	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Unknown	12369939
EGR1	Activation	21283769
ETV4	Unknown	11234878
FOS	Unknown	10471035
FOSL1	Unknown	10471035;11234878
FOSL2	Unknown	11234878
FOXP2	Activation	20858596
FOXP2	Unknown	21711233
JUN	Activation	16893520
JUN	Unknown	10471035;11234878;8761947
JUND	Unknown	10471035;11234878
NFKB1	Activation	19020743
NFKB1	Unknown	12244126
RELA	Activation	19020743
RELA	Unknown	12244126
SP1	Activation	14660675
SP1	Unknown	11234878;16261846;17317820
SP3	Unknown	16261846
SPDEF	Repression	12907642
TFAP2A	Unknown	17317820

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	22984561
GO:0005102	Function	Signaling receptor binding	IPI	12665524
GO:0005515	Function	Protein binding	IPI	11290596, 14764453, 15922359, 18718938, 24457100
GO:0005576	Component	Extracellular region	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	12665524
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006935	Process	Chemotaxis	TAS	10749881
GO:0007165	Process	Signal transduction	TAS	10749881
GO:0007596	Process	Blood coagulation	NAS	8392005
GO:0009986	Component	Cell surface	IDA	15922359
GO:0016021	Component	Integral component of membrane	NAS	1689240
GO:0019898	Component	Extrinsic component of membrane	TAS	8049431
GO:0019899	Function	Enzyme binding	IPI	14688365, 15922359
GO:0019904	Function	Protein domain specific binding	IPI	12665524
GO:0030162	Process	Regulation of proteolysis	NAS	1689240
GO:0030377	Function	Urokinase plasminogen activator receptor activity	NAS	1689240, 8392005
GO:0031225	Component	Anchored component of membrane	IEA
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IMP	21679692
GO:0035579	Component	Specific granule membrane	TAS
GO:0038023	Function	Signaling receptor activity	NAS	1689240, 8392005
GO:0038195	Process	Urokinase plasminogen activator signaling pathway	IEA
GO:0042730	Process	Fibrinolysis	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	22984561
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043388	Process	Positive regulation of DNA binding	IDA	22984561
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	22984561
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	22984561
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	22984561
GO:2001268	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	22984561

Other IDs

• MIM: 173391
• HGNC: 9053
• e!Ensembl: ENSG00000011422

Protein

• UniProt ID: Q03405
• Protein name: Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)
• Protein function: Acts as a receptor for urokinase plasminogen activator (PubMed:15677461). Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-
• PDB: 1YWH, 2FD6, 2I9B, 3BT1, 3BT2, 3U73, 3U74, 4K24, 4QTI, 7E17, 7V63
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00021	UPAR_LY6	25 → 99	u-PAR/Ly-6 domain	Domain
  PF00021	UPAR_LY6	216 → 294	u-PAR/Ly-6 domain	Domain

• Sequence:

  MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
  ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
  GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
  FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
  MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
  QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

• Sequence length: 335

Pathways

KEGG:

Complement and coagulation cascades
Proteoglycans in cancer

Reactome:

Attachment of GPI anchor to uPAR
Neutrophil degranulation
Dissolution of Fibrin Clot

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	21328570, 19360663
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	15302576
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	15302576

Unknown
Disease name	Disease term	dbSNP ID	References
Anaplastic carcinoma	Anaplastic carcinoma		15302576
Benign neoplasm	Benign Neoplasm		22261521
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Malignant neoplasm	Malignant Neoplasms		22261521
Neoplasms	Neoplasms		22261521
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Prostatic neoplasms	Prostatic Neoplasms		15302576
Still disease	Juvenile-Onset Still Disease		19565504