PLAU (plasminogen activator, urokinase)

Gene

• Entrez ID: 5328
• Gene name: Plasminogen activator, urokinase
• Gene symbol: PLAU
• Synonyms: ATF, BDPLT5, QPD, UPA, URK, u-PA
• Chromosome: 10
• Chromosome location: 10q22.2
• Summary: This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004291	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	19490101
MIRT004291	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	19490101
MIRT004413	hsa-miR-193b-3p	Western blot, Luciferase reporter assay	19701247
MIRT004291	hsa-miR-23b-3p	qRT-PCR, Western blot	21242962
MIRT024290	hsa-miR-215-5p	Microarray	19074876
MIRT026220	hsa-miR-192-5p	Microarray	19074876
MIRT004413	hsa-miR-193b-3p	Microarray, qRT-PCR, Western blot	23372348
MIRT127249	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT004413	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT127203	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT127204	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT127249	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT127249	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT1556808	hsa-miR-455-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2392609	hsa-miR-4690-3p	CLIP-seq
MIRT2392610	hsa-miR-4731-3p	CLIP-seq
MIRT2392611	hsa-miR-4801	CLIP-seq
MIRT2392612	hsa-miR-595	CLIP-seq
MIRT2595043	hsa-miR-1233	CLIP-seq
MIRT2595044	hsa-miR-146b-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2595045	hsa-miR-3074-3p	CLIP-seq
MIRT2595046	hsa-miR-3173-5p	CLIP-seq
MIRT2595047	hsa-miR-3591-5p	CLIP-seq
MIRT2595048	hsa-miR-361-5p	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2595049	hsa-miR-490-5p	CLIP-seq
MIRT2595050	hsa-miR-593	CLIP-seq
MIRT2595051	hsa-miR-767-3p	CLIP-seq
MIRT2595052	hsa-miR-874	CLIP-seq
MIRT2688006	hsa-miR-1200	CLIP-seq
MIRT2595043	hsa-miR-1233	CLIP-seq
MIRT2688007	hsa-miR-1275	CLIP-seq
MIRT2595044	hsa-miR-146b-3p	CLIP-seq
MIRT2070422	hsa-miR-181a	CLIP-seq
MIRT2070423	hsa-miR-181b	CLIP-seq
MIRT2070424	hsa-miR-181c	CLIP-seq
MIRT2070425	hsa-miR-181d	CLIP-seq
MIRT2688008	hsa-miR-192	CLIP-seq
MIRT2688009	hsa-miR-19a	CLIP-seq
MIRT2688010	hsa-miR-19b	CLIP-seq
MIRT2688011	hsa-miR-215	CLIP-seq
MIRT2595045	hsa-miR-3074-3p	CLIP-seq
MIRT2688012	hsa-miR-3074-5p	CLIP-seq
MIRT2688013	hsa-miR-3144-5p	CLIP-seq
MIRT2688014	hsa-miR-3150a-5p	CLIP-seq
MIRT2688015	hsa-miR-3150b-5p	CLIP-seq
MIRT2595046	hsa-miR-3173-5p	CLIP-seq
MIRT2688016	hsa-miR-329	CLIP-seq
MIRT2595048	hsa-miR-361-5p	CLIP-seq
MIRT2688017	hsa-miR-362-3p	CLIP-seq
MIRT2688018	hsa-miR-3925-3p	CLIP-seq
MIRT2688019	hsa-miR-3941	CLIP-seq
MIRT2070426	hsa-miR-4262	CLIP-seq
MIRT2688020	hsa-miR-4433	CLIP-seq
MIRT2688021	hsa-miR-4447	CLIP-seq
MIRT2688022	hsa-miR-4472	CLIP-seq
MIRT2688023	hsa-miR-4525	CLIP-seq
MIRT2688024	hsa-miR-4665-5p	CLIP-seq
MIRT2392609	hsa-miR-4690-3p	CLIP-seq
MIRT2688025	hsa-miR-4723-5p	CLIP-seq
MIRT2392610	hsa-miR-4731-3p	CLIP-seq
MIRT2688026	hsa-miR-4789-3p	CLIP-seq
MIRT2392611	hsa-miR-4801	CLIP-seq
MIRT2595049	hsa-miR-490-5p	CLIP-seq
MIRT2392612	hsa-miR-595	CLIP-seq
MIRT2688027	hsa-miR-603	CLIP-seq
MIRT2688028	hsa-miR-625	CLIP-seq
MIRT2688029	hsa-miR-648	CLIP-seq
MIRT2688030	hsa-miR-665	CLIP-seq
MIRT2688031	hsa-miR-711	CLIP-seq
MIRT2688032	hsa-miR-766	CLIP-seq
MIRT2595052	hsa-miR-874	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Unknown	10454570
ATF4	Activation	18829529
CREB1	Unknown	11776974
EGR1	Activation	21283769
ETS1	Unknown	10211993;11556732
FOS	Unknown	11774399
GATA6	Repression	15231498
HIF1A	Unknown	14567996
HOXD3	Unknown	14610084
ILF3	Activation	22986534
JUN	Unknown	10454570;11774399
NFKB1	Activation	11689575;17407600;20352621
POU2F1	Unknown	10951201
RARA	Unknown	10361124
RELA	Activation	11689575;17407600;20352621
RFWD2	Repression	12615916
RUNX2	Unknown	18331818
SP1	Unknown	10361124
SRF	Activation	15514113

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	3501295, 7904248, 10340997, 14696115, 18376415, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	18835034, 24434139
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006935	Process	Chemotaxis	TAS	10749881
GO:0007165	Process	Signal transduction	TAS	10749881
GO:0007596	Process	Blood coagulation	IEA
GO:0009986	Component	Cell surface	IDA	18835034
GO:0010469	Process	Regulation of signaling receptor activity	IDA	8837777
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014910	Process	Regulation of smooth muscle cell migration	IDA	8837777
GO:0030335	Process	Positive regulation of cell migration	IDA	25168896
GO:0031639	Process	Plasminogen activation	IBA	21873635
GO:0031639	Process	Plasminogen activation	IDA	25978044
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IBA	21873635
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	8837777
GO:0035579	Component	Specific granule membrane	TAS
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042730	Process	Fibrinolysis	IBA	21873635
GO:0042730	Process	Fibrinolysis	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0061041	Process	Regulation of wound healing	IC	8837777
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070821	Component	Tertiary granule membrane	TAS
GO:2000097	Process	Regulation of smooth muscle cell-matrix adhesion	IDA	8837777

Other IDs

• MIM: 191840
• HGNC: 9052
• e!Ensembl: ENSG00000122861

Protein

• UniProt ID: P00749
• Protein name: Urokinase-type plasminogen activator (U-plasminogen activator) (uPA) (EC 3.4.21.73) [Cleaved into: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen activator chain B]
• Protein function: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
• PDB: 1C5W, 1C5X, 1C5Y, 1C5Z, 1EJN, 1F5K, 1F5L, 1F92, 1FV9, 1GI7, 1GI8, 1GI9, 1GJ7, 1GJ8, 1GJ9, 1GJA, 1GJB, 1GJC, 1GJD, 1KDU, 1LMW, 1O3P, 1O5A, 1O5B, 1O5C, 1OWD, 1OWE, 1OWH, 1OWI, 1OWJ, 1OWK, 1SC8, 1SQA, 1SQO, 1SQT, 1U6Q, 1URK, 1VJ9, 1VJA, 1W0Z, 1W10, 1W11, 1W12, 1W13, 1W14, 2FD6, 2I9A, 2I9B, 2NWN, 2O8T, 2O8U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00051	Kringle	70 → 151	Kringle domain	Domain
  PF00089	Trypsin	179 → 419	Trypsin	Domain

• Sequence:

  MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
  HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
  YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
  GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
  RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
  PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
  CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
  SHTKEENGLAL

• Sequence length: 431

Pathways

KEGG:

NF-kappa B signaling pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Prostate cancer

Reactome:

Neutrophil degranulation
Dissolution of Fibrin Clot

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	10467400
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	21912604
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	10467400
Cerebral infarction	Cerebral Infarction	rs2230500	15502123, 12133459, 16773802
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Glomerulonephritis	IGA Glomerulonephritis	rs778043831	9002298
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	23128233
Moyamoya disease	Arterial Diseases, Common Carotid	rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410	10512912
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	3984876, 3068399, 2382605, 8416330, 2174952, 1908371
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431, rs200612497	10467400
Parkinson disease	Parkinsonian Disorders	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	16430655, 17192053, 11454671
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Pulmonary fibrosis	Idiopathic Pulmonary Fibrosis, Familial Idiopathic Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	18491991
Ventricular fibrillation	Ventricular Fibrillation	rs137854604, rs587782933, rs190140598	9083243

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		26974007
Arterial occlusive disease	Arterial Occlusive Diseases		1713745, 15557913, 9731615, 9181759
Asthenozoospermia	Asthenozoospermia		18998460
Atheromatous embolus	Cholesterol Embolism		16773802
Bone neoplasms	Bone neoplasms		16475674
Cerebral infraction	Infarction, Middle Cerebral Artery		15181847, 11677890, 17702958
Brain infarction	Subcortical Infarction		16773802, 12133459, 15502123
Carotid artery disease	Carotid Artery Diseases, External Carotid Artery Diseases, Internal Carotid Artery Diseases		10512912
Carotid atherosclerosis	Carotid Atherosclerosis		10512912
Cerebral embolism and thrombosis	Cerebral Embolism and Thrombosis		9403446
Cerebral ischemia	Brain Ischemia		9731615, 17927297, 10472989, 10512912
Cerebral thrombosis	Middle Cerebral Artery Thrombosis		17702958, 11677890, 15181847
Cerebrovascular disorders	Cerebrovascular Disorders		1265806, 17308290
Cerebrovascular insufficiency	Cerebrovascular Insufficiency		1265806, 17308290
Cerebrovascular occlusion	Cerebrovascular Occlusion		17308290, 1265806
Cholangitis	Cholangitis, Sclerosing		26974007
Coronary heart disease	Coronary heart disease	rs9289231, rs281864746	1730212, 9181759
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26192919, 28067908, 26974007
Dementia	Dementia
Diffuse interstitial pulmonary fibrosis	Hamman-Rich Disease		18491991
Embolism and thrombosis	Brain Embolism and Thrombosis		9403446
Henoch-schonlein nephritis	Henoch-Schoenlein Purpura		9002298, 12671112
Intermediate coronary syndrome	Angina, Unstable		2382605
Intracranial embolism and thrombosis	Intracranial Embolism and Thrombosis		9403446
Liver cirrhosis	Liver Cirrhosis		18481824, 26396155
Liver fibrosis	Fibrosis, Liver		26396155, 18481824
Malignant bone neoplasm	Malignant Bone Neoplasm		16475674
Myocardial rupture	Heart Rupture, Post-Infarction		9403446
Nephritis	Nephritis		12671112
Pancreatic neoplasm	Pancreatic Neoplasm		10467400
Prostatic neoplasms	Prostatic Neoplasms		16430655, 17192053, 11454671
Pulmonary thromboembolism	Pulmonary Thromboembolisms		11041470, 9038699, 4884574, 1098216, 9266785, 4430106
Quebec platelet disorder	Quebec platelet disorder	rs55744193, rs538342269, rs201591610, rs371106595, rs147372618, rs370278611, rs186447765, rs145865648, rs546931331, rs148333167, rs185909762, rs886047213, rs2227580, rs142059320, rs201299522, rs549461157, rs150389556, rs558920700, rs200165551, rs886047208, rs560674195, rs886047209, rs140559980, rs117134857, rs886047211, rs2227574, rs886047205, rs2227579, rs2227555, rs770181188, rs200927138, rs2227566, rs2227567, rs886047207, rs72816325, rs190769030, rs886047212, rs886047214, rs886047204, rs886047206, rs2227568, rs142117323, rs4065, rs565576288, rs145634997, rs886047210, rs545559536	20007542
Sagittal sinus thrombophlebitis	Sagittal Sinus Thrombophlebitis		10668740
Sagittal sinus thrombosis	Sagittal Sinus Thrombosis		10668740
Senile dementia	Presenile dementia, Acute Confusional Senile Dementia
Septic phlebitis, sagittal sinus	Septic Phlebitis, Sagittal Sinus		10668740
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923
Stroke	Cerebrovascular accident, Acute Cerebrovascular Accidents		12742636
Thrombosis	Deep Vein Thrombosis		6359570, 15557913, 3488869, 3161212
Ulcerative colitis	Ulcerative Colitis		26974007