PLA2G1B (phospholipase A2 group IB)

Gene

• Entrez ID: 5319
• Gene name: Phospholipase A2 group IB
• Gene symbol: PLA2G1B
• Synonyms: PLA2, PLA2A, PPLA2
• Chromosome: 12
• Chromosome location: 12q24.31
• Summary: This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to r

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	ISS	15528384, 16005851
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0002446	Process	Neutrophil mediated immunity	ISS	16005851
GO:0004623	Function	Phospholipase A2 activity	IDA	1918029
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005102	Function	Signaling receptor binding	IDA	1918029
GO:0005102	Function	Signaling receptor binding	IPI	7721806
GO:0005509	Function	Calcium ion binding	IDA	7060561
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	7060561, 12860195
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IDA	1918029
GO:0006654	Process	Phosphatidic acid biosynthetic process	TAS
GO:0007015	Process	Actin filament organization	TAS	9886417
GO:0007165	Process	Signal transduction	TAS	9886417
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	1918029
GO:0009986	Component	Cell surface	IDA	1918029
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	ISS	15528384
GO:0016042	Process	Lipid catabolic process	IDA	7060561
GO:0019370	Process	Leukotriene biosynthetic process	ISS	16005851
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0030141	Component	Secretory granule	IEA
GO:0030593	Process	Neutrophil chemotaxis	ISS	16005851
GO:0032052	Function	Bile acid binding	ISS	7060561
GO:0032431	Process	Activation of phospholipase A2 activity	TAS	17981679
GO:0032757	Process	Positive regulation of interleukin-8 production	ISS	15528384
GO:0032869	Process	Cellular response to insulin stimulus	ISS	1918029
GO:0035556	Process	Intracellular signal transduction	ISS	15528384
GO:0036148	Process	Phosphatidylglycerol acyl-chain remodeling	TAS
GO:0036149	Process	Phosphatidylinositol acyl-chain remodeling	TAS
GO:0036150	Process	Phosphatidylserine acyl-chain remodeling	TAS
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	TAS
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	15528384
GO:0046324	Process	Regulation of glucose import	ISS	1918029
GO:0046470	Process	Phosphatidylcholine metabolic process	IDA	7060561, 17603006
GO:0046471	Process	Phosphatidylglycerol metabolic process	IDA	1420353
GO:0047498	Function	Calcium-dependent phospholipase A2 activity	IDA	1420353, 7060561, 17603006
GO:0048146	Process	Positive regulation of fibroblast proliferation	IBA	21873635
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	1918029
GO:0050482	Process	Arachidonic acid secretion	TAS	12423354
GO:0050714	Process	Positive regulation of protein secretion	TAS	17981679
GO:0050778	Process	Positive regulation of immune response	ISS	16005851
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS	15528384
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195
GO:0102567	Function	Phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA
GO:0102568	Function	Phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA
GO:1904635	Process	Positive regulation of glomerular visceral epithelial cell apoptotic process	IDA	25335547

Other IDs

• MIM: 172410
• HGNC: 9030
• e!Ensembl: ENSG00000170890

Protein

• UniProt ID: P04054
• Protein name: Phospholipase A2 (EC 3.1.1.4) (Group IB phospholipase A2) (Phosphatidylcholine 2-acylhydrolase 1B)
• Protein function: Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract (PubMed:10681567, PubMed:1420353, PubMed:17603006). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of
• PDB: 3ELO, 6Q42
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00068	Phospholip_A2_1	24 → 138	Phospholipase A2	Domain

• Sequence:

  MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
  DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
  DRNAAICFSKAPYNKAHKNLDTKKYCQS

• Sequence length: 148

Pathways

KEGG:

Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption

Reactome:

Acyl chain remodelling of PC
Acyl chain remodelling of PS
Acyl chain remodelling of PE
Acyl chain remodelling of PI
Acyl chain remodelling of PG
Synthesis of PA

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	15318030, 17629734, 15999343

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		8750360, 14639048, 16829784, 9149325, 12895207
Mood disorder	Mood Disorders		14639048, 9149325