CPSF3 (cleavage and polyadenylation specific factor 3)

Gene

• Entrez ID: 51692
• Gene name: Cleavage and polyadenylation specific factor 3
• Gene symbol: CPSF3
• Synonyms: CPSF-73, CPSF73, NEDMHS, NEDMHSN
• Chromosome: 2
• Chromosome location: 2p25.1
• Summary: This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3`-cleavage site AAUAAA prior to p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023534	hsa-miR-1-3p	Proteomics	18668040
MIRT028443	hsa-miR-30a-5p	Proteomics	18668040
MIRT037757	hsa-miR-708-5p	CLASH	23622248
MIRT907229	hsa-miR-1297	CLIP-seq
MIRT907230	hsa-miR-1305	CLIP-seq
MIRT907231	hsa-miR-26a	CLIP-seq
MIRT907232	hsa-miR-26b	CLIP-seq
MIRT907233	hsa-miR-3973	CLIP-seq
MIRT907234	hsa-miR-4465	CLIP-seq
MIRT907235	hsa-miR-520g	CLIP-seq
MIRT907236	hsa-miR-520h	CLIP-seq
MIRT907237	hsa-miR-607	CLIP-seq
MIRT907233	hsa-miR-3973	CLIP-seq
MIRT907235	hsa-miR-520g	CLIP-seq
MIRT907236	hsa-miR-520h	CLIP-seq
MIRT907230	hsa-miR-1305	CLIP-seq
MIRT2204946	hsa-miR-331-5p	CLIP-seq
MIRT907233	hsa-miR-3973	CLIP-seq
MIRT2204947	hsa-miR-495	CLIP-seq
MIRT907235	hsa-miR-520g	CLIP-seq
MIRT907236	hsa-miR-520h	CLIP-seq
MIRT2204948	hsa-miR-548n	CLIP-seq
MIRT907237	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	TAS
GO:0003723	Function	RNA binding	IBA	21873635
GO:0003723	Function	RNA binding	ISS
GO:0004521	Function	Endoribonuclease activity	IBA	21873635
GO:0004521	Function	Endoribonuclease activity	ISS
GO:0005515	Function	Protein binding	IPI	18288197, 18688255, 21102410, 32814053
GO:0005654	Component	Nucleoplasm	TAS
GO:0005847	Component	MRNA cleavage and polyadenylation specificity factor complex	IBA	21873635
GO:0005847	Component	MRNA cleavage and polyadenylation specificity factor complex	IDA	18305108, 21102410
GO:0006369	Process	Termination of RNA polymerase II transcription	TAS
GO:0006378	Process	MRNA polyadenylation	IBA	21873635
GO:0006379	Process	MRNA cleavage	TAS	8929409
GO:0006398	Process	MRNA 3'-end processing by stem-loop binding and cleavage	IBA	21873635
GO:0006398	Process	MRNA 3'-end processing by stem-loop binding and cleavage	IDA	18688255
GO:0006406	Process	MRNA export from nucleus	TAS
GO:0008409	Function	5'-3' exonuclease activity	IBA	21873635
GO:0008409	Function	5'-3' exonuclease activity	ISS
GO:0031124	Process	MRNA 3'-end processing	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0090502	Process	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA

Other IDs

• MIM: 606029
• HGNC: 2326
• e!Ensembl: ENSG00000119203

Protein

• UniProt ID: Q9UKF6
• Protein name: Cleavage and polyadenylation specificity factor subunit 3 (EC 3.1.27.-) (Cleavage and polyadenylation specificity factor 73 kDa subunit) (CPSF 73 kDa subunit) (mRNA 3'-end-processing endonuclease CPSF-73)
• Protein function: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about c
• PDB: 2I7T, 2I7V, 6M8Q, 6V4X, 8T1Q, 8T1R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00753	Lactamase_B	20 → 262	Metallo-beta-lactamase superfamily	Domain
  PF10996	Beta-Casp	246 → 367	Beta-Casp domain	Domain
  PF07521	RMMBL	381 → 448	Zn-dependent metallo-hydrolase RNA specificity domain	Motif
  PF11718	CPSF73-100_C	479 → 682		Domain

• Sequence:

  MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLID
  PAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADD
  MLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDF
  SRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPV
  FALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININ
  NPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVE
  GTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
  QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQR
  VSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEEL
  EIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
  VSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSE
  DDESLREMVELAAQRLYEALTPVH

• Sequence length: 684

Pathways

KEGG:

mRNA surveillance pathway

Reactome:

Transport of Mature mRNA Derived from an Intronless Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243