CYRIB (CYFIP related Rac1 interactor B)

Gene

• Entrez ID: 51571
• Gene name: CYFIP related Rac1 interactor B
• Gene symbol: CYRIB
• Synonyms: BM-009, CYRI, CYRI-B, FAM49B, L1
• Chromosome: 8
• Chromosome location: 8q24.21

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002576	Process	Platelet degranulation	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005739	Component	Mitochondrion	IDA	29059164
GO:0005929	Component	Cilium	ISS
GO:0016020	Component	Membrane	IEA
GO:0023030	Function	MHC class Ib protein binding, via antigen binding groove	ISS
GO:0030334	Process	Regulation of cell migration	IMP	30250061
GO:0030837	Process	Negative regulation of actin filament polymerization	IMP	30250061
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031267	Function	Small GTPase binding	IPI	30250061, 31285585
GO:0032729	Process	Positive regulation of interferon-gamma production	ISS
GO:0050870	Process	Positive regulation of T cell activation	IBA	21873635
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0050920	Process	Regulation of chemotaxis	IMP	30250061
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IMP	30250061, 31285585
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0071219	Process	Cellular response to molecule of bacterial origin	IMP	31285585
GO:0090140	Process	Regulation of mitochondrial fission	IMP	29059164
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	30250061
GO:2000568	Process	Positive regulation of memory T cell activation	ISS

Other IDs

• MIM: 617978
• HGNC: 25216
• e!Ensembl: ENSG00000153310

Protein

• UniProt ID: Q9NUQ9
• Protein name: CYFIP-related Rac1 interactor B (L1)
• Protein function: Negatively regulates RAC1 signaling and RAC1-driven cytoskeletal remodeling (PubMed:30250061, PubMed:31285585). Regulates chemotaxis, cell migration and epithelial polarization by controlling the polarity, plasticity, duration and extent of prot
• PDB: 7AJK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07159	DUF1394	18 → 320	Protein of unknown function (DUF1394)	Family

• Sequence:

  MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAG
  HEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQ
  HLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVN
  NELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTDCLSTMASVCRVMLETPEY
  RSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDMKGCIKVLKDQPPNSVEGLL
  NALRYTTKHLNDETTSKQIKSMLQ

• Sequence length: 324

Pathways

KEGG:

Regulation of actin cytoskeleton

Reactome:

Platelet degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	30891314

Unknown
Disease name	Disease term	dbSNP ID	References
Heart failure	Heart Failure, Diastolic	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	29556499
Stress disorder	Post-Traumatic Stress Disorder		23726511