IL23A (interleukin 23 subunit alpha)

Gene

• Entrez ID: 51561
• Gene name: Interleukin 23 subunit alpha
• Gene symbol: IL23A
• Synonyms: IL-23, IL-23A, IL23P19, P19, SGRF
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific su

Transcription factors

Transcription factor	Regulation	Reference
CEBPD	Activation	23028973
E2F1	Unknown	17707233
JUN	Unknown	17569750;22904313
NFKB1	Activation	17569750
NFKB1	Unknown	17707233
RELA	Activation	17569750
RELA	Unknown	17707233

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	NAS	20027291
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	TAS	16751425
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	11114383, 12023369, 18680750, 25416956, 29997244, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0010536	Process	Positive regulation of activation of Janus kinase activity	IBA	21873635
GO:0010536	Process	Positive regulation of activation of Janus kinase activity	IDA	12023369
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	11114383, 17888176, 20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	TAS	19088061
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IBA	21873635
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	11114383
GO:0042509	Process	Regulation of tyrosine phosphorylation of STAT protein	IDA	12023369
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12023369, 19088061
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048771	Process	Tissue remodeling	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IBA	21873635
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	TAS	20428758
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	IBA	21873635
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

Other IDs

• MIM: 605580
• HGNC: 15488
• e!Ensembl: ENSG00000110944

Protein

• UniProt ID: Q9NPF7
• Protein name: Interleukin-23 subunit alpha (IL-23 subunit alpha) (IL-23-A) (Interleukin-23 subunit p19) (IL-23p19)
• Protein function: Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity (PubMed:11114383). Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric
• PDB: 3D85, 3D87, 3DUH, 3QWR, 4GRW, 5MJ3, 5MJ4, 5MXA, 5MZV, 5NJD, 6UIB, 6WDQ, 8CR8, 8OE4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16649	IL23	28 → 184	Interleukin 23 subunit alpha	Domain

• Sequence:

  MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
  DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
  VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
  AHGAATLSP

• Sequence length: 189

Pathways

KEGG:

Cytokine-cytokine receptor interaction
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th17 cell differentiation
Pertussis
Tuberculosis
Pathways in cancer
Inflammatory bowel disease
Rheumatoid arthritis

Reactome:

Interleukin-4 and Interleukin-13 signaling
Interleukin-23 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	19169254, 20953190
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	19192274

Unknown
Disease name	Disease term	dbSNP ID	References
Palmoplantar pustules	Pustulosis of Palms and Soles		19169254, 20953190