SFMBT1 (Scm like with four mbt domains 1)

Gene

• Entrez ID: 51460
• Gene name: Scm like with four mbt domains 1
• Gene symbol: SFMBT1
• Synonyms: RU1, SFMBT, hSFMBT
• Chromosome: 3
• Chromosome location: 3p21.1
• Summary: This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. [provided by RefSeq, Jun 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029891	hsa-miR-26b-5p	Microarray	19088304
MIRT052054	hsa-let-7b-5p	CLASH	23622248
MIRT050135	hsa-miR-26a-5p	CLASH	23622248
MIRT1341601	hsa-miR-1252	CLIP-seq
MIRT1341602	hsa-miR-142-5p	CLIP-seq
MIRT1341603	hsa-miR-340	CLIP-seq
MIRT1341604	hsa-miR-3616-3p	CLIP-seq
MIRT1341605	hsa-miR-4252	CLIP-seq
MIRT1341606	hsa-miR-4264	CLIP-seq
MIRT1341607	hsa-miR-4422	CLIP-seq
MIRT1341608	hsa-miR-4476	CLIP-seq
MIRT1341609	hsa-miR-4722-3p	CLIP-seq
MIRT1341610	hsa-miR-4797-3p	CLIP-seq
MIRT1341611	hsa-miR-619	CLIP-seq
MIRT1341612	hsa-miR-875-3p	CLIP-seq
MIRT1341613	hsa-let-7a	CLIP-seq
MIRT1341614	hsa-let-7b	CLIP-seq
MIRT1341615	hsa-let-7c	CLIP-seq
MIRT1341616	hsa-let-7d	CLIP-seq
MIRT1341617	hsa-let-7e	CLIP-seq
MIRT1341618	hsa-let-7f	CLIP-seq
MIRT1341619	hsa-let-7g	CLIP-seq
MIRT1341620	hsa-let-7i	CLIP-seq
MIRT1341621	hsa-miR-1205	CLIP-seq
MIRT1341622	hsa-miR-1225-3p	CLIP-seq
MIRT1341623	hsa-miR-1238	CLIP-seq
MIRT1341624	hsa-miR-1264	CLIP-seq
MIRT1341625	hsa-miR-1283	CLIP-seq
MIRT1341626	hsa-miR-196a	CLIP-seq
MIRT1341627	hsa-miR-196b	CLIP-seq
MIRT1341628	hsa-miR-30a	CLIP-seq
MIRT1341629	hsa-miR-30b	CLIP-seq
MIRT1341630	hsa-miR-30c	CLIP-seq
MIRT1341631	hsa-miR-30d	CLIP-seq
MIRT1341632	hsa-miR-30e	CLIP-seq
MIRT1341633	hsa-miR-3689a-3p	CLIP-seq
MIRT1341634	hsa-miR-3689c	CLIP-seq
MIRT1341635	hsa-miR-421	CLIP-seq
MIRT1341636	hsa-miR-4257	CLIP-seq
MIRT1341637	hsa-miR-4323	CLIP-seq
MIRT1341638	hsa-miR-4458	CLIP-seq
MIRT1341639	hsa-miR-4500	CLIP-seq
MIRT1341640	hsa-miR-4709-5p	CLIP-seq
MIRT1341641	hsa-miR-4728-5p	CLIP-seq
MIRT1341642	hsa-miR-4759	CLIP-seq
MIRT1341643	hsa-miR-98	CLIP-seq
MIRT1341644	hsa-miR-125a-3p	CLIP-seq
MIRT1341645	hsa-miR-3665	CLIP-seq
MIRT1341646	hsa-miR-651	CLIP-seq
MIRT1341647	hsa-miR-657	CLIP-seq
MIRT2101146	hsa-miR-190	CLIP-seq
MIRT2101147	hsa-miR-190b	CLIP-seq
MIRT1341635	hsa-miR-421	CLIP-seq
MIRT2101148	hsa-miR-4633-5p	CLIP-seq
MIRT2101149	hsa-miR-4677-3p	CLIP-seq
MIRT1341640	hsa-miR-4709-5p	CLIP-seq
MIRT2101150	hsa-miR-532-5p	CLIP-seq
MIRT2101151	hsa-miR-595	CLIP-seq
MIRT1341613	hsa-let-7a	CLIP-seq
MIRT1341614	hsa-let-7b	CLIP-seq
MIRT1341615	hsa-let-7c	CLIP-seq
MIRT1341616	hsa-let-7d	CLIP-seq
MIRT1341617	hsa-let-7e	CLIP-seq
MIRT1341618	hsa-let-7f	CLIP-seq
MIRT1341619	hsa-let-7g	CLIP-seq
MIRT1341620	hsa-let-7i	CLIP-seq
MIRT1341636	hsa-miR-4257	CLIP-seq
MIRT1341638	hsa-miR-4458	CLIP-seq
MIRT1341639	hsa-miR-4500	CLIP-seq
MIRT2325556	hsa-miR-628-5p	CLIP-seq
MIRT1341643	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	TAS	23592795
GO:0005515	Function	Protein binding	IPI	16189514, 17599839, 23592795, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	17599839
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042393	Function	Histone binding	IBA	21873635
GO:0042393	Function	Histone binding	IDA	17599839, 23592795
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	23592795
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	17599839, 23349461
GO:0048635	Process	Negative regulation of muscle organ development	IMP	23349461

Other IDs

• MIM: 607319
• HGNC: 20255
• e!Ensembl: ENSG00000163935

Protein

• UniProt ID: Q9UHJ3
• Protein name: Scm-like with four MBT domains protein 1 (hSFMBT) (Renal ubiquitous protein 1)
• Protein function: Histone-binding protein, which is part of various corepressor complexes. Mediates the recruitment of corepressor complexes to target genes, followed by chromatin compaction and repression of transcription. Plays a role during myogenesis: require
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02820	MBT	54 → 124	mbt repeat	Domain
  PF02820	MBT	167 → 236	mbt repeat	Domain
  PF02820	MBT	279 → 352	mbt repeat	Domain
  PF02820	MBT	388 → 457	mbt repeat	Domain
  PF12140	SLED	502 → 617	SLED domain	Domain
  PF00536	SAM_1	794 → 857	SAM domain (Sterile alpha motif)	Domain

• Sequence:

  MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAV
  RTDPETYWVATVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAP
  EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTW
  IVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKN
  EAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKV
  FDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWAD
  YLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEG
  SKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVH
  EGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLRE
  VLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFC
  RQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACA
  LKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGEDEDDPDEGDDDSLSEGSTSE
  QQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDENKPPSPKEIR
  IEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMD
  LKLGPAIKLCHHIERIKFAFYEQFAN

• Sequence length: 866

Pathways

KEGG:

Polycomb repressive complex

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	26198764

Unknown
Disease name	Disease term	dbSNP ID	References
Gout	Gout		31578528, 23263486
Gouty arthritis	Arthritis, Gouty		23263486, 31578528
Hyperuricemia	Hyperuricemia		29124443
Kidney failure	Kidney Failure, Chronic		29124443
Ulcerative colitis	Ulcerative Colitis		23128233, 26192919