WNT16 (Wnt family member 16)

Gene

• Entrez ID: 51384
• Gene name: Wnt family member 16
• Gene symbol: WNT16
• Synonyms: -
• Chromosome: 7
• Chromosome location: 7q31.31
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025130	hsa-miR-181a-5p	Microarray	17612493
MIRT650766	hsa-miR-5584-5p	HITS-CLIP	23824327
MIRT650765	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT650764	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT650763	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT650762	hsa-miR-4261	HITS-CLIP	23824327
MIRT650761	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT650760	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT650759	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT650758	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT650757	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT650756	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT650755	hsa-miR-4447	HITS-CLIP	23824327
MIRT650753	hsa-miR-4472	HITS-CLIP	23824327
MIRT650754	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT650752	hsa-miR-4477a	HITS-CLIP	23824327
MIRT650751	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT734469	hsa-miR-941	RNA-seq, Western blotting	32560314
MIRT650766	hsa-miR-5584-5p	HITS-CLIP	23824327
MIRT650765	hsa-miR-200a-5p	HITS-CLIP	23824327
MIRT650764	hsa-miR-200b-5p	HITS-CLIP	23824327
MIRT650763	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT650762	hsa-miR-4261	HITS-CLIP	23824327
MIRT650761	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT650760	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT650759	hsa-miR-6721-5p	HITS-CLIP	23824327
MIRT650758	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT650757	hsa-miR-491-5p	HITS-CLIP	23824327
MIRT650756	hsa-miR-3151-5p	HITS-CLIP	23824327
MIRT650755	hsa-miR-4447	HITS-CLIP	23824327
MIRT650753	hsa-miR-4472	HITS-CLIP	23824327
MIRT650754	hsa-miR-6742-5p	HITS-CLIP	23824327
MIRT650752	hsa-miR-4477a	HITS-CLIP	23824327
MIRT650751	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT1493613	hsa-miR-323-3p	CLIP-seq
MIRT1493614	hsa-miR-361-3p	CLIP-seq
MIRT1493615	hsa-miR-4436b-5p	CLIP-seq
MIRT1493616	hsa-miR-4474-5p	CLIP-seq
MIRT1493617	hsa-miR-4661-3p	CLIP-seq
MIRT1493618	hsa-miR-4803	CLIP-seq
MIRT1493619	hsa-miR-889	CLIP-seq
MIRT1493620	hsa-miR-181a	CLIP-seq
MIRT1493621	hsa-miR-181b	CLIP-seq
MIRT1493622	hsa-miR-181c	CLIP-seq
MIRT1493623	hsa-miR-181d	CLIP-seq
MIRT1493624	hsa-miR-3143	CLIP-seq
MIRT1493625	hsa-miR-3671	CLIP-seq
MIRT1493626	hsa-miR-4262	CLIP-seq
MIRT1493627	hsa-miR-543	CLIP-seq
MIRT1493628	hsa-miR-607	CLIP-seq
MIRT2148784	hsa-miR-145	CLIP-seq
MIRT2148785	hsa-miR-3180-5p	CLIP-seq
MIRT2148785	hsa-miR-3180-5p	CLIP-seq
MIRT2369178	hsa-miR-4272	CLIP-seq
MIRT2369179	hsa-miR-587	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003408	Process	Optic cup formation involved in camera-type eye development	ISS	16258938
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	10500199
GO:0005737	Component	Cytoplasm	IDA	17200136
GO:0010628	Process	Positive regulation of gene expression	IMP	16007226
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IMP	19951988
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030216	Process	Keratinocyte differentiation	IMP	17200136
GO:0043616	Process	Keratinocyte proliferation	IMP	17200136
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17200136
GO:0046849	Process	Bone remodeling	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060548	Process	Negative regulation of cell death	IMP	17200136
GO:0090399	Process	Replicative senescence	IMP	19951988
GO:0090403	Process	Oxidative stress-induced premature senescence	IMP	19951988

Other IDs

• MIM: 606267
• HGNC: 16267
• e!Ensembl: ENSG00000002745

Protein

• UniProt ID: Q9UBV4
• Protein name: Protein Wnt-16
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	49 → 365	wnt family	Family

• Sequence:

  MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
  KRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
  AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
  KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
  SFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
  GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
  VHTCK

• Sequence length: 365

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs1801155, rs121908380, rs121908702, rs267606674, rs4939827, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553149467, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	30251476

Unknown
Disease name	Disease term	dbSNP ID	References
Ischemic myocardial dysfunction	Ischemic cardiomyopathy		30251476