GediPNet logo

SLC45A2 (solute carrier family 45 member 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51151
Gene nameGene Name - the full gene name approved by the HGNC.
Solute carrier family 45 member 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SLC45A2
SynonymsGene synonyms aliases
1A1, AIM1, MATP, OCA4, SHEP5
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a transporter protein that mediates melanin synthesis. The protein is expressed in a high percentage of melanoma cell lines. Mutations in this gene are a cause of oculocutaneous albinism type 4, and polymorphisms in this gene are associa
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs116887602 G>A,C,T Pathogenic-likely-pathogenic, benign Intron variant, coding sequence variant, stop gained, synonymous variant
rs121912619 A>G Pathogenic, uncertain-significance Coding sequence variant, 3 prime UTR variant, missense variant
rs121912620 G>A Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant
rs121912621 C>T Pathogenic Coding sequence variant, missense variant
rs146802593 C>G Uncertain-significance, likely-pathogenic Coding sequence variant, intron variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1364483 hsa-miR-1202 CLIP-seq
MIRT1364484 hsa-miR-1255a CLIP-seq
MIRT1364485 hsa-miR-1255b CLIP-seq
MIRT1364486 hsa-miR-1827 CLIP-seq
MIRT1364487 hsa-miR-3915 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0007601 Process Visual perception IEA
GO:0008506 Function Sucrose:proton symporter activity IBA 21873635
GO:0008506 Function Sucrose:proton symporter activity ISS
GO:0015770 Process Sucrose transport ISS
GO:0016020 Component Membrane IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9UMX9
Protein name Membrane-associated transporter protein (Melanoma antigen AIM1) (Protein AIM-1) (Solute carrier family 45 member 2)
Protein function Proton-associated glucose and sucrose transporter (By similarity). May be able to transport also fructose (By similarity). Expressed at a late melanosome maturation stage where functions as proton/glucose exporter which increase lumenal pH by de
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13347 MFS_2
37 261
Family
Sequence
MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVL
LSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALY
LNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGL
HYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEA
PLTEVAKGIPPQQTPQDPPLS
SDGMYEYGSIEKVKNGYVNPELAMQGAKNKNHAEQTRRA
MTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEF
LIYERGVEVGCWGLCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPN
VYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKERQQAPGGDPDNSVRGKGMDCATLT
CMVQLAQILVGGGLGFLVNTAGTVVVVVITASAVALIGCCFVALFVRYVD
Sequence length 530
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Melanin biosynthesis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Albinism Albinism rs28940876, rs387906560, rs62635045, rs140365820, rs141949212, rs1384042381, rs62635042
Basal cell neoplasm Basal Cell Neoplasm, Basal Cell Cancer rs587776578, rs587776579, rs2117956624, rs2118419579, rs2118365442, rs2118041703, rs2136689212, rs2118336503, rs1587692888, rs267606984, rs878853849, rs1554695110, rs1064793921, rs1588605348, rs1588568813 31174203, 27539887
Carcinoma Basal cell carcinoma, Squamous cell carcinoma, Carcinoma, Basal Cell rs121912654, rs555607708, rs786202962, rs1564055259 31174203, 27539887, 19578363, 31174203, 26829030, 19578363
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 18563784, 21983787, 21559390, 28212542
Unknown
Disease name Disease term dbSNP ID References
Disorder of eye Disorder of eye
Melanosis Melanosis 30166351
Skin carcinoma Squamous cell carcinoma of skin 27424798
Strabismus Strabismus

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412