GediPNet logo

IRAK4 (interleukin 1 receptor associated kinase 4)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51135
Gene nameGene Name - the full gene name approved by the HGNC.
Interleukin 1 receptor associated kinase 4
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IRAK4
SynonymsGene synonyms aliases
IMD67, IPD1, IRAK-4, NY-REN-64, REN64
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q12
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurre
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs114951157 C>T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs121908002 C>T Pathogenic Coding sequence variant, stop gained, genic downstream transcript variant
rs377584435 C>T Likely-pathogenic, pathogenic Intron variant, missense variant, coding sequence variant, 5 prime UTR variant
rs758539498 G>A,T Pathogenic Genic downstream transcript variant, intron variant
rs944235493 A>G Pathogenic Genic downstream transcript variant, intron variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024734 hsa-miR-215-5p Microarray 19074876
MIRT026168 hsa-miR-192-5p Microarray 19074876
MIRT438882 hsa-miR-132-3p Luciferase reporter assay 23264652
MIRT438882 hsa-miR-132-3p Luciferase reporter assay 23264652
MIRT438881 hsa-miR-212-3p Luciferase reporter assay 23264652
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0002224 Process Toll-like receptor signaling pathway TAS 21269878
GO:0002446 Process Neutrophil mediated immunity IMP 19663824
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 21269878
GO:0004672 Function Protein kinase activity EXP 11960013
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9NWZ3
Protein name Interleukin-1 receptor-associated kinase 4 (IRAK-4) (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-64)
Protein function Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways (PubMed:17878374). Is rapidly recruited by MYD88 to the
PDB 2NRU , 2NRY , 2O8Y , 2OIB , 2OIC , 2OID , 3MOP , 4RMZ , 4U97 , 4U9A , 4XS2 , 4Y73 , 4YO6 , 4YP8 , 4ZTL , 4ZTM , 4ZTN , 5K72 , 5K75 , 5K76 , 5K7G , 5K7I , 5KX7 , 5KX8 , 5T1S , 5T1T , 5UIQ , 5UIR , 5UIS , 5UIT , 5UIU , 5W84 , 5W85 , 6EG9 , 6EGA , 6EGD , 6EGE , 6EGF , 6F3D , 6F3E , 6F3G , 6F3I , 6LXY , 6MOM , 6N8G , 6O8U , 6O94 , 6O95 , 6O9D , 6RFI , 6RFJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07714 PK_Tyr_Ser-Thr
187 454
Protein tyrosine and serine/threonine kinase
Domain
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLL
QEMTAS
Sequence length 460
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Neurotrophin signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Yersinia infection
Leishmaniasis
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Lipid and atherosclerosis
  PIP3 activates AKT signaling
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
IRAK4 deficiency (TLR5)
IRAK4 deficiency (TLR2/4)
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Interleukin-1 signaling
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome
MyD88 cascade initiated on plasma membrane
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Immunodeficiency Immunodeficiency due to interleukin-1 receptor-associated kinase-4 deficiency rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866, rs483352928, rs121918659, rs111033580, rs111033581, rs74315290, rs193922740, rs193922741, rs104894199, rs483352927, rs104894286, rs1571865049, rs886041032, rs2069709, rs587776822, rs74315444, rs587776823, rs1315265916, rs104893893, rs104893894, rs121434560, rs387906572, rs587776853, rs104893973, rs587776854, rs587776855, rs587776857, rs104893974, rs121912715, rs1393707607, rs113994136, rs387906593, rs587776870, rs387906763, rs387906913, rs199469663, rs199469662, rs199469664, rs193922640, rs193922641, rs193922645, rs398122890, rs387907316, rs397514710, rs398122383, rs397515453, rs397514332, rs398123058, rs397518423, rs587777075, rs199676861, rs77563738, rs587777337, rs28730670, rs587777389, rs587777390, rs587777413, rs587777414, rs587777415, rs587777416, rs267608260, rs267608261, rs587778405, rs587777446, rs587777562, rs587777564, rs587777565, rs869320745, rs587777709, rs606231305, rs672601318, rs727503779, rs727503780, rs730880296, rs786200953, rs375323253, rs794729666, rs886041037, rs886041038, rs796051887, rs796051888, rs749956849, rs199641706, rs775739391, rs869312886, rs869312857, rs879253731, rs879253732, rs201025290, rs770927552, rs878853275, rs878853276, rs878853277, rs878853278, rs1567506566, rs886037920, rs886037921, rs750610248, rs200044623, rs886043118, rs886060531, rs1057519074, rs1057519075, rs1057518744, rs1057519079, rs1057518745, rs1057518746, rs1057518747, rs782178147, rs55729925, rs1064795762, rs1064794957, rs1085307649, rs745463649, rs773694113, rs1192554889, rs779575307, rs1554051075, rs1554051067, rs1554051033, rs1554067182, rs1555167566, rs1555169270, rs1555908409, rs1555719963, rs1554064929, rs768091235, rs1404084330, rs144104577, rs1553238837, rs1553243550, rs1554020278, rs1554066684, rs762678772, rs570768621, rs1443126481, rs1553721236, rs121434258, rs888230251, rs1759915032, rs1759514836, rs138156467, rs1560914625, rs755373718, rs1561423197, rs1560938296, rs200803157, rs766555082, rs201543770, rs114951157, rs775578531, rs201128237, rs778624945, rs1563340753, rs1561772403, rs1484948342, rs777878144, rs1562364898, rs1561254290, rs1569296295, rs1568815169, rs1568822574, rs1571880832, rs934523851, rs1922072844, rs1266114717, rs137869655, rs869320689, rs1571880941, rs1580875488, rs1581303476, rs1448018291, rs1390410878, rs774803573, rs1591278347, rs1602300615, rs1601340933, rs757598952, rs1181595292, rs1408683294, rs1595843113, rs1595848141, rs779560450, rs1595816926, rs1601861196, rs1601861199, rs756541321, rs1594389703, rs1594390415, rs1581401865, rs1236009877, rs753213766, rs778993919, rs1602878106, rs141698985, rs1264504989, rs1580974401, rs2093571190, rs530286781, rs2086875746, rs2089298923, rs1206185362, rs1581573705, rs1596718225, rs1004337827, rs1573613529, rs1574636674, rs1574657735, rs1574657762, rs1574672718, rs1581573640, rs1553657429, rs200666300, rs1578735747, rs1578771211, rs1578793312, rs1578795536, rs1578809101, rs1578811073, rs1578811245, rs1171694504, rs1578971328, rs140800288, rs374333820, rs1584926133, rs1585040113, rs1584409386, rs1379376784, rs1586940273, rs1587143342, rs748910652, rs1592117677, rs758555433, rs1596712783, rs34019455, rs147766868, rs751386365, rs1600631294, rs1489114116, rs1057520578, rs1603007888, rs1603008329, rs1574450161, rs1578735709, rs1403833564, rs1580262965, rs570910902, rs1589866171, rs1578999313, rs1582635229, rs1582637044, rs1580851910, rs1750760771, rs745453685, rs1249197356, rs201840561, rs1940921909, rs1941410085, rs1941465194, rs1321690789, rs1302362911, rs1730552437, rs2052705192, rs1941856970
Neutropenia Neutropenia rs879253882
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 16537705
Unknown
Disease name Disease term dbSNP ID References
Anorexia Anoxia-Ischemia, Brain, Anoxia-Ischemia, Cerebral 21925238
Anoxic-ischemic encephalopathy Anoxic-Ischemic Encephalopathy 21925238
Cerebral hypoxia-ischemia Cerebral Hypoxia-Ischemia 21925238
Hypoxic-ischemic encephalopathy Hypoxic-Ischemic Encephalopathy 21925238

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412