CALY (calcyon neuron specific vesicular protein)

Gene

• Entrez ID: 50632
• Gene name: Calcyon neuron specific vesicular protein
• Gene symbol: CALY
• Synonyms: DRD1IP, NSG3
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT860007	hsa-miR-3135b	CLIP-seq
MIRT860008	hsa-miR-3652	CLIP-seq
MIRT860009	hsa-miR-4430	CLIP-seq
MIRT860010	hsa-miR-4492	CLIP-seq
MIRT860011	hsa-miR-4498	CLIP-seq
MIRT860012	hsa-miR-4508	CLIP-seq
MIRT860013	hsa-miR-4706	CLIP-seq
MIRT860014	hsa-miR-4734	CLIP-seq
MIRT860015	hsa-miR-4749-5p	CLIP-seq
MIRT860016	hsa-miR-604	CLIP-seq
MIRT860017	hsa-miR-744	CLIP-seq
MIRT860018	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16595675
GO:0005768	Component	Endosome	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	14534309
GO:0007212	Process	Dopamine receptor signaling pathway	IEA
GO:0008089	Process	Anterograde axonal transport	IEA
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016197	Process	Endosomal transport	IBA	21873635
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	14534309, 16595675
GO:0032051	Function	Clathrin light chain binding	IBA	21873635
GO:0032051	Function	Clathrin light chain binding	IDA	16595675
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	16595675
GO:0048268	Process	Clathrin coat assembly	IBA	21873635
GO:0048268	Process	Clathrin coat assembly	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IMP	16595675
GO:0098884	Process	Postsynaptic neurotransmitter receptor internalization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:1905445	Process	Positive regulation of clathrin coat assembly	IEA
GO:2001019	Process	Positive regulation of retrograde axon cargo transport	IEA

Other IDs

• MIM: 604647
• HGNC: 17938
• e!Ensembl: ENSG00000130643

Protein

• UniProt ID: Q9NYX4
• Protein name: Neuron-specific vesicular protein calcyon
• Protein function: Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06387	Calcyon	1 → 181	D1 dopamine receptor-interacting protein (calcyon)	Family

• Sequence:

  MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
  QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
  HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
  QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

• Sequence length: 217

Pathways

KEGG:

Dopaminergic synapse

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs120074176, rs786205019	30753204
Hypertension	Essential Hypertension	rs13306026, rs13333226	30753204
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	14755439, 15364041

Unknown
Disease name	Disease term	dbSNP ID	References
Memory disorders	Memory Disorders		30753204
Age-related memory disorders	Age-Related Memory Disorders		30753204
Minimal brain dysfunction	Minimal Brain Dysfunction		30753204