IL20 (interleukin 20)

Gene

• Entrez ID: 50604
• Gene name: Interleukin 20
• Gene symbol: IL20
• Synonyms: IL-20, IL10D, ZCYTO10
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053417	hsa-miR-624-3p	Microarray	23807165
MIRT1064475	hsa-miR-103a	CLIP-seq
MIRT1064476	hsa-miR-107	CLIP-seq
MIRT1064477	hsa-miR-1183	CLIP-seq
MIRT1064478	hsa-miR-15a	CLIP-seq
MIRT1064479	hsa-miR-15b	CLIP-seq
MIRT1064480	hsa-miR-16	CLIP-seq
MIRT1064481	hsa-miR-195	CLIP-seq
MIRT1064482	hsa-miR-3163	CLIP-seq
MIRT1064483	hsa-miR-424	CLIP-seq
MIRT1064484	hsa-miR-4524	CLIP-seq
MIRT1064485	hsa-miR-4693-5p	CLIP-seq
MIRT1064486	hsa-miR-497	CLIP-seq
MIRT1064487	hsa-miR-503	CLIP-seq
MIRT1064488	hsa-miR-568	CLIP-seq
MIRT1064489	hsa-miR-646	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	TAS	11470428
GO:0005615	Component	Extracellular space	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	TAS	11470428
GO:0045517	Function	Interleukin-20 receptor binding	TAS	11470428
GO:0045518	Function	Interleukin-22 receptor binding	IEA
GO:0045606	Process	Positive regulation of epidermal cell differentiation	TAS	11470428
GO:0045618	Process	Positive regulation of keratinocyte differentiation	TAS	11470428
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0050727	Process	Regulation of inflammatory response	TAS	11470428

Other IDs

• MIM: 605619
• HGNC: 6002
• e!Ensembl: ENSG00000162891

Protein

• UniProt ID: Q9NYY1
• Protein name: Interleukin-20 (IL-20) (Cytokine Zcyto10)
• Protein function: Pro-inflammatory and angiogenic cytokine mainly secreted by monocytes and skin keratinocytes that plays crucial roles in immune responses, regulation of inflammatory responses, hemopoiesis, as well as epidermal cell and keratinocyte differentiat
• PDB: 4DOH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00726	IL10	20 → 175	Interleukin 10	Domain

• Sequence:

  MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
  DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
  KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

• Sequence length: 176

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway

Reactome:

Interleukin-20 family signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	19430480

Unknown
Disease name	Disease term	dbSNP ID	References
Autoimmune diabetes	Diabetes, Autoimmune		19430480
Brittle diabetes mellitus	Brittle diabetes		19430480
Kidney failure	Kidney Failure, Acute		18496552
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	19087313
Oral ulcer	Oral Ulcer		30837455
Acute kidney insufficiency	Acute Kidney Insufficiency		18496552