OSM (oncostatin M)

Gene

• Entrez ID: 5008
• Gene name: Oncostatin M
• Gene symbol: OSM
• Synonyms: -
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1206723	hsa-miR-1231	CLIP-seq
MIRT1206724	hsa-miR-1302	CLIP-seq
MIRT1206725	hsa-miR-193a-5p	CLIP-seq
MIRT1206726	hsa-miR-3122	CLIP-seq
MIRT1206727	hsa-miR-3140-3p	CLIP-seq
MIRT1206728	hsa-miR-3163	CLIP-seq
MIRT1206729	hsa-miR-3192	CLIP-seq
MIRT1206730	hsa-miR-340	CLIP-seq
MIRT1206731	hsa-miR-3689a-3p	CLIP-seq
MIRT1206732	hsa-miR-3689c	CLIP-seq
MIRT1206733	hsa-miR-3689d	CLIP-seq
MIRT1206734	hsa-miR-3913-5p	CLIP-seq
MIRT1206735	hsa-miR-3934	CLIP-seq
MIRT1206736	hsa-miR-4298	CLIP-seq
MIRT1206737	hsa-miR-4527	CLIP-seq
MIRT1206738	hsa-miR-4728-5p	CLIP-seq
MIRT1206739	hsa-miR-548a-3p	CLIP-seq
MIRT1206740	hsa-miR-548c-3p	CLIP-seq
MIRT1206741	hsa-miR-548e	CLIP-seq
MIRT1206742	hsa-miR-548f	CLIP-seq
MIRT2287851	hsa-miR-106a	CLIP-seq
MIRT2287852	hsa-miR-106b	CLIP-seq
MIRT2287853	hsa-miR-17	CLIP-seq
MIRT2287854	hsa-miR-20a	CLIP-seq
MIRT2287855	hsa-miR-20b	CLIP-seq
MIRT2287856	hsa-miR-3176	CLIP-seq
MIRT2287857	hsa-miR-3609	CLIP-seq
MIRT2287858	hsa-miR-3649	CLIP-seq
MIRT2287859	hsa-miR-3661	CLIP-seq
MIRT2287860	hsa-miR-3670	CLIP-seq
MIRT2287861	hsa-miR-3922-3p	CLIP-seq
MIRT2287862	hsa-miR-4492	CLIP-seq
MIRT2287863	hsa-miR-4498	CLIP-seq
MIRT2287864	hsa-miR-4508	CLIP-seq
MIRT2287865	hsa-miR-4796-3p	CLIP-seq
MIRT2287866	hsa-miR-492	CLIP-seq
MIRT2287867	hsa-miR-519d	CLIP-seq
MIRT2287868	hsa-miR-548ah	CLIP-seq
MIRT2287869	hsa-miR-631	CLIP-seq
MIRT2287870	hsa-miR-661	CLIP-seq
MIRT2287871	hsa-miR-762	CLIP-seq
MIRT2287872	hsa-miR-93	CLIP-seq
MIRT2287873	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	10391682

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002675	Process	Positive regulation of acute inflammatory response	IC	8999038
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	8999038
GO:0005147	Function	Oncostatin-M receptor binding	IPI	8999038
GO:0005515	Function	Protein binding	IPI	16051226, 28514442
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	IEA
GO:0007275	Process	Multicellular organism development	TAS	1717982
GO:0008083	Function	Growth factor activity	IDA	8999038
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8999038
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1717982
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IGI	28972028
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	28972028
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0038165	Process	Oncostatin-M-mediated signaling pathway	IDA	8999038
GO:0040008	Process	Regulation of growth	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0050729	Process	Positive regulation of inflammatory response	IDA	28972028
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917, 8999038
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IGI	28972028
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS	1542793

Other IDs

• MIM: 165095
• HGNC: 8506
• e!Ensembl: ENSG00000099985

Protein

• UniProt ID: P13725
• Protein name: Oncostatin-M (OSM)
• Protein function: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (he
• PDB: 1EVS, 8V29, 8V2A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01291	LIF_OSM	37 → 209	LIF / OSM family	Domain

• Sequence:

  MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
  RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
  QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
  ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
  GKRLMTRGQLPR

• Sequence length: 252

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
JAK-STAT signaling pathway

Reactome:

Interleukin-4 and Interleukin-13 signaling
IL-6-type cytokine receptor ligand interactions

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Unknown
Disease name	Disease term	dbSNP ID	References
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504