ORM1 (orosomucoid 1)

Gene

• Entrez ID: 5004
• Gene name: Orosomucoid 1
• Gene symbol: ORM1
• Synonyms: AGP-A, AGP1, HEL-S-153w, ORM
• Chromosome: 9
• Chromosome location: 9q32
• Summary: This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002576	Process	Platelet degranulation	TAS
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16272158
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	8774350
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	TAS	3360326
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	23973664
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	23973664
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	8774350
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8774350
GO:0035580	Component	Specific granule lumen	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 138600
• HGNC: 8498
• e!Ensembl: ENSG00000229314

Protein

• UniProt ID: P02763
• Protein name: Alpha-1-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1)
• Protein function: Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
• PDB: 3KQ0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	40 → 180	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
  EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
  ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
  DKCEPLEKQHEKERKQEEGES

• Sequence length: 201

Pathways

Reactome:

Platelet degranulation
Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Liver failure	Liver Failure	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682	18256743

Unknown
Disease name	Disease term	dbSNP ID	References
Kidney failure	Kidney Failure, Acute		28885000
Acute kidney insufficiency	Acute Kidney Insufficiency		28885000