OPRD1 (opioid receptor delta 1)

Gene

• Entrez ID: 4985
• Gene name: Opioid receptor delta 1
• Gene symbol: OPRD1
• Synonyms: DOP, DOR, DOR1, OPRD
• Chromosome: 1
• Chromosome location: 1p35.3

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs678849	C>G,T	Drug-response	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037618	hsa-miR-744-5p	CLASH	23622248
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT1204460	hsa-miR-3909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004985	Function	Opioid receptor activity	IDA	22184124
GO:0005515	Function	Protein binding	IPI	15086532, 20528919, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006955	Process	Immune response	TAS	9548483
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16325578
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7808419
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	24613828
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030285	Component	Integral component of synaptic vesicle membrane	IEA
GO:0031226	Component	Intrinsic component of plasma membrane	IDA	22184124
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	24613828
GO:0032590	Component	Dendrite membrane	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	IC	24613828
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	24613828
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0038003	Process	Opioid receptor signaling pathway	IBA	21873635
GO:0038003	Process	Opioid receptor signaling pathway	IMP	9548483
GO:0038046	Function	Enkephalin receptor activity	IBA	21873635
GO:0038046	Function	Enkephalin receptor activity	IMP	9548483
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043679	Component	Axon terminus	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	24613828
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	24613828
GO:0097237	Process	Cellular response to toxic substance	IDA	24613828
GO:0097444	Component	Spine apparatus	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA

Other IDs

• MIM: 165195
• HGNC: 8153
• e!Ensembl: ENSG00000116329

Protein

• UniProt ID: P41143
• Protein name: Delta-type opioid receptor (D-OR-1) (DOR-1)
• Protein function: G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and mo
• PDB: 4N6H, 4RWA, 4RWD, 6PT2, 6PT3, 8F7S, 8Y45
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
  AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
  CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
  VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
  RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
  HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
  TPSDGPGGGAAA

• Sequence length: 372

Pathways

KEGG:

cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	2415332
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	26198764