GediPNet logo

NRGN (neurogranin)
Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4900
Gene nameGene Name - the full gene name approved by the HGNC.
Neurogranin
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NRGN
SynonymsGene synonyms aliases
RC3, hng
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.2
SummarySummary of gene provided in NCBI Entrez Gene.
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The ex
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT492851 hsa-miR-744-5p PAR-CLIP 23592263
MIRT492850 hsa-miR-665 PAR-CLIP 23592263
MIRT492849 hsa-miR-3940-3p PAR-CLIP 23592263
MIRT492848 hsa-miR-3141 PAR-CLIP 23592263
MIRT492847 hsa-miR-6840-3p PAR-CLIP 23592263
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0005516 Function Calmodulin binding IEA
GO:0005547 Function Phosphatidylinositol-3,4,5-trisphosphate binding IEA
GO:0005634 Component Nucleus IEA
GO:0005829 Component Cytosol TAS
GO:0007165 Process Signal transduction TAS 10075657
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q92686
Protein name Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)]
Protein function Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00612 IQ
27 → 47
IQ calmodulin-binding motif
 Motif
Sequence 
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG
PGGAGVARGGAGGGPSGD
Sequence length 78
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
Reactome
    Long-term potentiation
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 31374203, 28991256, 17140601, 25056061, 29483656, 26198764, 30285260, 28540026, 30804558, 31268507
Unknown
Disease name Disease term dbSNP ID References
Bipolar disorder Bipolar Disorder 21037240
Development disorder Child Development Disorders, Pervasive 28540026, 30804558

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412