NPY5R (neuropeptide Y receptor Y5)

Gene

• Entrez ID: 4889
• Gene name: Neuropeptide Y receptor Y5
• Gene symbol: NPY5R
• Synonyms: NPY5-R, NPYR5, NPYY5-R
• Chromosome: 4
• Chromosome location: 4q32.2
• Summary: The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1191810	hsa-miR-106a	CLIP-seq
MIRT1191811	hsa-miR-106b	CLIP-seq
MIRT1191812	hsa-miR-17	CLIP-seq
MIRT1191813	hsa-miR-20a	CLIP-seq
MIRT1191814	hsa-miR-20b	CLIP-seq
MIRT1191815	hsa-miR-3609	CLIP-seq
MIRT1191816	hsa-miR-4509	CLIP-seq
MIRT1191817	hsa-miR-4744	CLIP-seq
MIRT1191818	hsa-miR-4796-3p	CLIP-seq
MIRT1191819	hsa-miR-4799-5p	CLIP-seq
MIRT1191820	hsa-miR-519d	CLIP-seq
MIRT1191821	hsa-miR-548ah	CLIP-seq
MIRT1191822	hsa-miR-93	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IBA	21873635
GO:0001602	Function	Pancreatic polypeptide receptor activity	IBA	21873635
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	8824284
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8824284
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007568	Process	Aging	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0016020	Component	Membrane	IBA	21873635
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045202	Component	Synapse	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0060112	Process	Generation of ovulation cycle rhythm	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

Other IDs

• MIM: 602001
• HGNC: 7958
• e!Ensembl: ENSG00000164129

Protein

• UniProt ID: Q15761
• Protein name: Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor) (NPYY5-R) (Y5 receptor)
• Protein function: Receptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	58 → 425	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
  LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
  QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
  VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
  GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
  ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
  KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
  NPILYGFLNNGIKADLVSLIHCLHM

• Sequence length: 445

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	10849579