NPY1R (neuropeptide Y receptor Y1)

Gene

• Entrez ID: 4886
• Gene name: Neuropeptide Y receptor Y1
• Gene symbol: NPY1R
• Synonyms: NPY1-R, NPYR
• Chromosome: 4
• Chromosome location: 4q32.2
• Summary: This gene belongs to the G-protein-coupled receptor superfamily. The encoded transmembrane protein mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. The encoded receptor undergoes fast agonist-induced internalization through clathrin-coated pits and is subsequently recycled back to the cell membrane. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity. [provided by RefSeq, Aug 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018353	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IEA
GO:0001602	Function	Pancreatic polypeptide receptor activity	IBA	21873635
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	1317848
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	1317848
GO:0006006	Process	Glucose metabolic process	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1317848
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	1321422
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007631	Process	Feeding behavior	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA

Other IDs

• MIM: 162641
• HGNC: 7956
• e!Ensembl: ENSG00000164128

Protein

• UniProt ID: P25929
• Protein name: Neuropeptide Y receptor type 1 (NPY1-R)
• Protein function: Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is NPY > [Pro-34] PYY, PYY and [Leu-31, Pro-34] NPY > NPY (2-36) > [Ile-31, Gln-34] PP and PYY (3-36) > PP > NPY free acid.
• PDB: 2F1U, 2IIL, 5ZBQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 320	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
  LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
  CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
  DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
  RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
  LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
  KTSLKQASPVAFKKINNNDDNEKI

• Sequence length: 384

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Disease name	Disease term	References
	Acrania	17400914
	Iniencephaly	17400914
	Exencephaly	17400914
	Anxiety Disorders	11440811
	Anxiety States, Neurotic	11440811
	Craniorachischisis	17400914
	Diastematomyelia	17400914
	Melancholia	9729278
	Endogenous depression	9729278
	Depressive disorder	9729278
	Unipolar Depression	9729278
	Depressive Syndrome	9729278
	Depression, Neurotic	9729278
	Neural Tube Defects	17400914
	Neurenteric Cyst	17400914
	Nonorganic psychosis	19566775
	Obesity	20975297
	Tethered Cord Syndrome	17400914
	Psychotic Disorders	19566775
	Schizophrenia	14741323, 21512575
	Spinal Cord Myelodysplasia	17400914