NNMT (nicotinamide N-methyltransferase)

Gene

• Entrez ID: 4837
• Gene name: Nicotinamide N-methyltransferase
• Gene symbol: NNMT
• Synonyms: -
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 200

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022959	hsa-miR-124-3p	Microarray	18668037
MIRT027710	hsa-miR-98-5p	Microarray	19088304
MIRT689992	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT689991	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT689990	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT689989	hsa-miR-4459	HITS-CLIP	23313552
MIRT689988	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT689987	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT689986	hsa-miR-6086	HITS-CLIP	23313552
MIRT689985	hsa-miR-6765-5p	HITS-CLIP	23313552
MIRT689984	hsa-miR-1304-5p	HITS-CLIP	23313552
MIRT689992	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT689991	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT689990	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT689989	hsa-miR-4459	HITS-CLIP	23313552
MIRT689988	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT689987	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT689986	hsa-miR-6086	HITS-CLIP	23313552
MIRT689985	hsa-miR-6765-5p	HITS-CLIP	23313552
MIRT689984	hsa-miR-1304-5p	HITS-CLIP	23313552

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0008112	Function	Nicotinamide N-methyltransferase activity	IBA	21873635
GO:0008112	Function	Nicotinamide N-methyltransferase activity	TAS
GO:0008170	Function	N-methyltransferase activity	IBA	21873635
GO:0010243	Process	Response to organonitrogen compound	IEA
GO:0030760	Function	Pyridine N-methyltransferase activity	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032259	Process	Methylation	TAS
GO:0034356	Process	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS
GO:0042493	Process	Response to drug	IEA

Other IDs

• MIM: 600008
• HGNC: 7861
• e!Ensembl: ENSG00000166741

Protein

• UniProt ID: P40261
• Protein name: Nicotinamide N-methyltransferase (EC 2.1.1.1)
• Protein function: Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PubMed:21823666, PubMed:23
• PDB: 2IIP, 3ROD, 5YJF, 6CHH, 6ORR, 6PVE, 6PVS, 7BKG, 7BLE, 7EGU, 7EHZ, 7EI2, 7ET7, 7EU5, 7NBJ, 7NBM, 7NBQ, 7RKK, 7RKL, 7SOK, 7WMC, 7WMT, 9ATV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01234	NNMT_PNMT_TEMT	1 → 259	NNMT/PNMT/TEMT family	Family

• Sequence:

  MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
  DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
  RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
  RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
  SYSSTMANNEGLFSLVARKLSRPL

• Sequence length: 264

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways

Reactome:

Methylation
Nicotinamide salvaging

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21791160, 25317069

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		24004542
Liver carcinoma	Liver carcinoma		28284560