Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
4826 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Neuronatin |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
NNAT |
SynonymsGene synonyms aliases
|
Peg5 |
ChromosomeChromosome number
|
20 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
20q11.23 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found |
miRNAmiRNA information provided by mirtarbase database.
|
miRTarBase ID |
miRNA |
Experiments |
Reference |
MIRT054416 |
hsa-miR-198 |
Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot |
24519663 |
MIRT054416 |
hsa-miR-198 |
Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot |
24519663 |
MIRT054899 |
hsa-miR-708-5p |
Luciferase reporter assay |
23328481 |
MIRT054899 |
hsa-miR-708-5p |
Luciferase reporter assay |
23328481 |
MIRT054899 |
hsa-miR-708-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
26075749 |
MIRT1188113 |
hsa-miR-1285 |
CLIP-seq |
|
MIRT1188114 |
hsa-miR-149 |
CLIP-seq |
|
MIRT1188115 |
hsa-miR-1539 |
CLIP-seq |
|
MIRT1188116 |
hsa-miR-2277-3p |
CLIP-seq |
|
MIRT1188117 |
hsa-miR-2277-5p |
CLIP-seq |
|
MIRT1188118 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT1188119 |
hsa-miR-296-5p |
CLIP-seq |
|
MIRT1188120 |
hsa-miR-3074-5p |
CLIP-seq |
|
MIRT1188121 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT1188122 |
hsa-miR-3187-5p |
CLIP-seq |
|
MIRT1188123 |
hsa-miR-3193 |
CLIP-seq |
|
MIRT1188124 |
hsa-miR-3202 |
CLIP-seq |
|
MIRT1188125 |
hsa-miR-323-5p |
CLIP-seq |
|
MIRT1188126 |
hsa-miR-339-5p |
CLIP-seq |
|
MIRT1188127 |
hsa-miR-3667-3p |
CLIP-seq |
|
MIRT1188128 |
hsa-miR-3909 |
CLIP-seq |
|
MIRT1188129 |
hsa-miR-4281 |
CLIP-seq |
|
MIRT1188130 |
hsa-miR-4425 |
CLIP-seq |
|
MIRT1188131 |
hsa-miR-4475 |
CLIP-seq |
|
MIRT1188132 |
hsa-miR-4479 |
CLIP-seq |
|
MIRT1188133 |
hsa-miR-4490 |
CLIP-seq |
|
MIRT1188134 |
hsa-miR-4667-3p |
CLIP-seq |
|
MIRT1188135 |
hsa-miR-4667-5p |
CLIP-seq |
|
MIRT1188136 |
hsa-miR-4691-5p |
CLIP-seq |
|
MIRT1188137 |
hsa-miR-4700-5p |
CLIP-seq |
|
MIRT1188138 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT1188139 |
hsa-miR-4747-5p |
CLIP-seq |
|
MIRT1188140 |
hsa-miR-4774-5p |
CLIP-seq |
|
MIRT1188141 |
hsa-miR-612 |
CLIP-seq |
|
MIRT1188142 |
hsa-miR-665 |
CLIP-seq |
|
MIRT1188143 |
hsa-miR-708 |
CLIP-seq |
|
MIRT1188144 |
hsa-miR-892b |
CLIP-seq |
|
MIRT2054522 |
hsa-miR-19a |
CLIP-seq |
|
MIRT2054523 |
hsa-miR-19b |
CLIP-seq |
|
MIRT1188118 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT2054524 |
hsa-miR-3130-3p |
CLIP-seq |
|
MIRT1188121 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT1188128 |
hsa-miR-3909 |
CLIP-seq |
|
MIRT2054525 |
hsa-miR-3936 |
CLIP-seq |
|
MIRT1188136 |
hsa-miR-4691-5p |
CLIP-seq |
|
MIRT1188138 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT2054526 |
hsa-miR-518a-5p |
CLIP-seq |
|
MIRT2054527 |
hsa-miR-527 |
CLIP-seq |
|
MIRT1188142 |
hsa-miR-665 |
CLIP-seq |
|
MIRT1188143 |
hsa-miR-708 |
CLIP-seq |
|
MIRT1188118 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT1188121 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT1188128 |
hsa-miR-3909 |
CLIP-seq |
|
MIRT1188136 |
hsa-miR-4691-5p |
CLIP-seq |
|
MIRT1188138 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT1188142 |
hsa-miR-665 |
CLIP-seq |
|
MIRT1188143 |
hsa-miR-708 |
CLIP-seq |
|
MIRT1188118 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT1188121 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT1188128 |
hsa-miR-3909 |
CLIP-seq |
|
MIRT1188136 |
hsa-miR-4691-5p |
CLIP-seq |
|
MIRT1188138 |
hsa-miR-4731-5p |
CLIP-seq |
|
MIRT1188142 |
hsa-miR-665 |
CLIP-seq |
|
MIRT1188143 |
hsa-miR-708 |
CLIP-seq |
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q16517 |
Protein name |
Neuronatin |
Protein function |
May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels. |
Family and domains |
|
Sequence |
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL AYTVSRTGRQVLGERRQRAPN
|
|
Sequence length |
81 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Lung carcinoma |
Non-Small Cell Lung Carcinoma |
rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 |
17043644 |
Neuroblastoma |
Neuroblastoma |
rs121908161, rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544 |
17762496 |
|
|
|
| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412 |