GediPNet logo

NNAT (neuronatin)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4826
Gene nameGene Name - the full gene name approved by the HGNC.
Neuronatin
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NNAT
SynonymsGene synonyms aliases
Peg5
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.23
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT054416 hsa-miR-198 Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24519663
MIRT054416 hsa-miR-198 Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24519663
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assay, qRT-PCR, Western blot 26075749
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA 21873635
GO:0007420 Process Brain development IBA 21873635
GO:0009249 Process Protein lipoylation TAS 8813377
GO:0032024 Process Positive regulation of insulin secretion IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q16517
Protein name Neuronatin
Protein function May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
Family and domains
Sequence
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN
Sequence length 81
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 17043644
Neuroblastoma Neuroblastoma rs121908161, rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544 17762496

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412