ATP1B1 (ATPase Na+/K+ transporting subunit beta 1)

Gene

• Entrez ID: 481
• Gene name: ATPase Na+/K+ transporting subunit beta 1
• Gene symbol: ATP1B1
• Synonyms: ATP1B
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007176	hsa-miR-192-5p	Luciferase reporter assay	23221637
MIRT441154	hsa-miR-218-5p	HITS-CLIP	23212916

Transcription factors

Transcription factor	Regulation	Reference
NR3C1	Repression	9694812
NR3C1	Unknown	11216640
NR3C2	Repression	9694812
NR3C2	Unknown	11216640
PGR	Unknown	22330642

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001671	Function	ATPase activator activity	IBA	21873635
GO:0001671	Function	ATPase activator activity	IDA	10636900, 19542013, 23954377
GO:0001671	Function	ATPase activator activity	IGI	16861705, 18728015, 20100892
GO:0005515	Function	Protein binding	IPI	17947299, 22328087, 25012180, 25902260, 28298427, 30021884, 32814053
GO:0005886	Component	Plasma membrane	IDA	18522992
GO:0005886	Component	Plasma membrane	IGI	19751721
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IBA	21873635
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IDA	10636900, 19542013, 23954377
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IGI	18728015
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	IPI	16861705
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0005901	Component	Caveola	IEA
GO:0006874	Process	Cellular calcium ion homeostasis	ISS
GO:0006883	Process	Cellular sodium ion homeostasis	IBA	21873635
GO:0006883	Process	Cellular sodium ion homeostasis	IDA	10636900, 19542013
GO:0007155	Process	Cell adhesion	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	TAS	18075585
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010882	Process	Regulation of cardiac muscle contraction by calcium ion signaling	ISS
GO:0014704	Component	Intercalated disc	ISS
GO:0016020	Component	Membrane	IDA	23954377
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	11193188
GO:0016328	Component	Lateral plasma membrane	IDA	11193188
GO:0019901	Function	Protein kinase binding	IEA
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030007	Process	Cellular potassium ion homeostasis	IBA	21873635
GO:0030007	Process	Cellular potassium ion homeostasis	IDA	10636900, 19542013
GO:0030315	Component	T-tubule	IGI	19751721
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	10636900, 18075585
GO:0030674	Function	Protein-macromolecule adaptor activity	IGI	16861705
GO:0031090	Component	Organelle membrane	IGI	19751721
GO:0032781	Process	Positive regulation of ATPase activity	IDA	10636900
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0035725	Process	Sodium ion transmembrane transport	IGI	16861705
GO:0036126	Component	Sperm flagellum	IDA	16861705
GO:0036376	Process	Sodium ion export across plasma membrane	IBA	21873635
GO:0036376	Process	Sodium ion export across plasma membrane	IDA	10636900
GO:0036376	Process	Sodium ion export across plasma membrane	ISS
GO:0042383	Component	Sarcolemma	ISS
GO:0044861	Process	Protein transport into plasma membrane raft	TAS	19683723
GO:0046034	Process	ATP metabolic process	IDA	23954377
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0050821	Process	Protein stabilization	IDA	10636900
GO:0050821	Process	Protein stabilization	ISS
GO:0050900	Process	Leukocyte migration	TAS
GO:0051117	Function	ATPase binding	IPI	10636900, 16861705, 23954377
GO:0055119	Process	Relaxation of cardiac muscle	ISS
GO:0060048	Process	Cardiac muscle contraction	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0072659	Process	Protein localization to plasma membrane	IDA	18522992
GO:0086009	Process	Membrane repolarization	IDA	19542013
GO:0086013	Process	Membrane repolarization during cardiac muscle cell action potential	IC	19542013
GO:0086064	Process	Cell communication by electrical coupling involved in cardiac conduction	TAS	19683723
GO:0098655	Process	Cation transmembrane transport	IGI	20100892
GO:1901018	Process	Positive regulation of potassium ion transmembrane transporter activity	IDA	10636900
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IDA	10636900, 19542013
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	IGI	18728015
GO:1903278	Process	Positive regulation of sodium ion export across plasma membrane	ISS
GO:1903281	Process	Positive regulation of calcium:sodium antiporter activity	ISS
GO:1903288	Process	Positive regulation of potassium ion import across plasma membrane	IDA	10636900, 19542013, 23954377
GO:1903288	Process	Positive regulation of potassium ion import across plasma membrane	IGI	16861705, 18728015, 20100892
GO:1903408	Process	Positive regulation of sodium:potassium-exchanging ATPase activity	IDA	10636900, 19542013, 23954377
GO:1903408	Process	Positive regulation of sodium:potassium-exchanging ATPase activity	IGI	18728015, 20100892
GO:1903408	Process	Positive regulation of sodium:potassium-exchanging ATPase activity	ISS
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1990573	Process	Potassium ion import across plasma membrane	IBA	21873635
GO:1990573	Process	Potassium ion import across plasma membrane	ISS

Other IDs

• MIM: 182330
• HGNC: 804
• e!Ensembl: ENSG00000143153

Protein

• UniProt ID: P05026
• Protein name: Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1)
• Protein function: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. ; Involved in cell adhesion and establishing epithelial cell polarity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00287	Na_K-ATPase	3 → 297	Sodium / potassium ATPase beta chain	Family

• Sequence:

  MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
  ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
  MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL
  NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
  QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
  VKS

• Sequence length: 303

Pathways

KEGG:

cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Cytoskeleton in muscle cells
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone synthesis and secretion
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption

Reactome:

Basigin interactions
Ion homeostasis
Ion transport by P-type ATPases

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs-1, rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	17330099
Hypertension	Essential Hypertension	rs13306026
Myeloid leukemia	Acute Myeloid Leukemia, M1	rs-1	17330099