NHLH2 (nescient helix-loop-helix 2)

Gene

• Entrez ID: 4808
• Gene name: Nescient helix-loop-helix 2
• Gene symbol: NHLH2
• Synonyms: HEN2, HH27, NSCL2, bHLHa34
• Chromosome: 1
• Chromosome location: 1p13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT450041	hsa-miR-4714-5p	PAR-CLIP	22100165
MIRT450040	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT450039	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450038	hsa-miR-4635	PAR-CLIP	22100165
MIRT450037	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450041	hsa-miR-4714-5p	PAR-CLIP	22100165
MIRT450040	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT450039	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450038	hsa-miR-4635	PAR-CLIP	22100165
MIRT450037	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT1184301	hsa-miR-154	CLIP-seq
MIRT1184302	hsa-miR-3065-5p	CLIP-seq
MIRT1184303	hsa-miR-3133	CLIP-seq
MIRT1184304	hsa-miR-342-3p	CLIP-seq
MIRT1184305	hsa-miR-3613-3p	CLIP-seq
MIRT1184306	hsa-miR-4695-3p	CLIP-seq
MIRT1184307	hsa-miR-498	CLIP-seq
MIRT1184308	hsa-miR-548ac	CLIP-seq
MIRT1184309	hsa-miR-548b-3p	CLIP-seq
MIRT1184310	hsa-miR-548d-3p	CLIP-seq
MIRT1184311	hsa-miR-548z	CLIP-seq
MIRT1184301	hsa-miR-154	CLIP-seq
MIRT2686291	hsa-miR-27a	CLIP-seq
MIRT2686292	hsa-miR-27b	CLIP-seq
MIRT2686293	hsa-miR-3919	CLIP-seq
MIRT2686294	hsa-miR-3925-5p	CLIP-seq
MIRT2686295	hsa-miR-494	CLIP-seq
MIRT2686296	hsa-miR-513a-5p	CLIP-seq
MIRT2686297	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	16314316
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	22169038, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	TAS	16314316
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0007417	Process	Central nervous system development	TAS	1328219
GO:0008584	Process	Male gonad development	IEA
GO:0021535	Process	Cell migration in hindbrain	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042698	Process	Ovulation cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	16314316
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	TAS	16314316
GO:0060179	Process	Male mating behavior	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 162361
• HGNC: 7818
• e!Ensembl: ENSG00000177551

Protein

• UniProt ID: Q02577
• Protein name: Helix-loop-helix protein 2 (HEN-2) (Class A basic helix-loop-helix protein 34) (bHLHa34) (Nescient helix loop helix 2) (NSCL-2)
• Protein function: Transcription factor which binds the E box motif 5'-CA[TC][AG]TG-3'. Involved in regulating energy expenditure, body mass, voluntary physical activity, mating behavior and reproductive longevity, acting through the hypothalamic-pituitary-gonadal
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	78 → 130	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
  QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
  LAICYISYLNHVLDV

• Sequence length: 135

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	20808804