NGFR (nerve growth factor receptor)

Gene

• Entrez ID: 4804
• Gene name: Nerve growth factor receptor
• Gene symbol: NGFR
• Synonyms: CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
• Chromosome: 17
• Chromosome location: 17q21.33
• Summary: Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016762	hsa-miR-335-5p	Microarray	18185580
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT1184143	hsa-miR-1827	CLIP-seq
MIRT1184144	hsa-miR-1909	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT1184147	hsa-miR-28-5p	CLIP-seq
MIRT1184148	hsa-miR-3139	CLIP-seq
MIRT1184149	hsa-miR-3150a-3p	CLIP-seq
MIRT1184150	hsa-miR-3175	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT1184153	hsa-miR-3670	CLIP-seq
MIRT1184154	hsa-miR-3936	CLIP-seq
MIRT1184155	hsa-miR-3943	CLIP-seq
MIRT1184156	hsa-miR-4277	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT1184159	hsa-miR-4688	CLIP-seq
MIRT1184160	hsa-miR-4722-3p	CLIP-seq
MIRT1184161	hsa-miR-4727-5p	CLIP-seq
MIRT1184162	hsa-miR-4768-5p	CLIP-seq
MIRT1184163	hsa-miR-498	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184166	hsa-miR-708	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT1184168	hsa-miR-939	CLIP-seq
MIRT1184169	hsa-miR-942	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT2053383	hsa-miR-2467-3p	CLIP-seq
MIRT2053384	hsa-miR-3126-5p	CLIP-seq
MIRT2053385	hsa-miR-3173-3p	CLIP-seq
MIRT2053386	hsa-miR-3184	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT2053387	hsa-miR-377	CLIP-seq
MIRT2053388	hsa-miR-3941	CLIP-seq
MIRT2053389	hsa-miR-423-5p	CLIP-seq
MIRT2053390	hsa-miR-4324	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053392	hsa-miR-466	CLIP-seq
MIRT2053393	hsa-miR-4672	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2053395	hsa-miR-4695-5p	CLIP-seq
MIRT2053396	hsa-miR-4779	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT2282604	hsa-miR-186	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT2282605	hsa-miR-2964a-3p	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT2282606	hsa-miR-4505	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2282607	hsa-miR-513a-5p	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT2391537	hsa-miR-2681	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYCN	Repression	21123453

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001678	Process	Cellular glucose homeostasis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1846035
GO:0005035	Function	Death receptor activity	IBA	21873635
GO:0005035	Function	Death receptor activity	IGI	11927634
GO:0005515	Function	Protein binding	IPI	11756426, 14593116, 14966521, 14985763, 19131967, 19225519, 20659559, 21982860, 23559013, 32814053
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	16712417
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	3022937
GO:0005911	Component	Cell-cell junction	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	26268439
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0007266	Process	Rho protein signal transduction	IBA	21873635
GO:0007266	Process	Rho protein signal transduction	IDA	16712417
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0015026	Function	Coreceptor activity	IBA	21873635
GO:0015026	Function	Coreceptor activity	IDA	16712417
GO:0016021	Component	Integral component of membrane	NAS	11927634
GO:0016048	Process	Detection of temperature stimulus	IEA
GO:0021675	Process	Nerve development	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031267	Function	Small GTPase binding	ISS
GO:0031293	Process	Membrane protein intracellular domain proteolysis	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035907	Process	Dorsal aorta development	IEA
GO:0038023	Function	Signaling receptor activity	TAS	3022937
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043121	Function	Neurotrophin binding	ISS
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043281	Process	Regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	TAS
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048406	Function	Nerve growth factor binding	IBA	21873635
GO:0048406	Function	Nerve growth factor binding	ISS
GO:0050771	Process	Negative regulation of axonogenesis	TAS
GO:0050772	Process	Positive regulation of axonogenesis	TAS
GO:0051402	Process	Neuron apoptotic process	IGI	11927634
GO:0051799	Process	Negative regulation of hair follicle development	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26268439
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	26268439
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	26268439
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11927634
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 162010
• HGNC: 7809
• e!Ensembl: ENSG00000064300

Protein

• UniProt ID: P08138
• Protein name: Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor
• Protein function: Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24
• PDB: 2N80, 2N83, 2N97, 3EWV, 5ZGG, 7CSQ, 8X8T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	109 → 146	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	149 → 188	TNFR/NGFR cysteine-rich region	Domain
  PF18422	TNFR_16_TM	246 → 283	Tumor necrosis factor receptor member 16 trans-membrane domain	Domain
  PF00531	Death	344 → 421	Death domain	Domain

• Sequence:

  MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
  QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
  RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
  TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
  PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
  LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
  HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
  STATSPV

• Sequence length: 427

Pathways

KEGG:

Virion - Ebolavirus, Lyssavirus and Morbillivirus
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis - multiple species
Neurotrophin signaling pathway
Transcriptional misregulation in cancer

Reactome:

Axonal growth inhibition (RHOA activation)
Regulated proteolysis of p75NTR
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18056468, 17409433
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18470533
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	10436046

Unknown
Disease name	Disease term	dbSNP ID	References
Clonic seizures	Clonic Seizures		10436046
Degenerative diseases, central nervous system	Degenerative Diseases, Central Nervous System, Degenerative Diseases, Spinal Cord		12097334
Hypotonic seizures	Epileptic drop attack		10436046
Jacksonian seizure	Jacksonian Seizure		10436046
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	15883381, 15274039, 15883381
Neurodegenerative disorders	Neurodegenerative Disorders		12097334
Prostatic neoplasms	Prostatic Neoplasms		18056468, 17409433