GediPNet logo

NGF (nerve growth factor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4803
Gene nameGene Name - the full gene name approved by the HGNC.
Nerve growth factor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NGF
SynonymsGene synonyms aliases
Beta-NGF, HSAN5, NGFB
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p13.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the d
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT733688 hsa-let-7a-5p ELISA, Luciferase reporter assay, qRT-PCR, Western blotting 31925656
Transcription factors
Transcription factor Regulation Reference
FOS Unknown 2111020
ING4 Repression 22078444
JUN Unknown 2111020
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000186 Process Activation of MAPKK activity TAS
GO:0005163 Function Nerve growth factor receptor binding IBA 21873635
GO:0005163 Function Nerve growth factor receptor binding IPI 14985763
GO:0005515 Function Protein binding IPI 10490030, 14985763, 15131306, 18596692, 19122660, 32814053
GO:0005576 Component Extracellular region TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P01138
Protein name Beta-nerve growth factor (Beta-NGF)
Protein function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems (PubMed:14976160, PubMed:20978020). Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades
PDB 1SG1 , 1WWW , 2IFG , 4EDW , 4EDX , 4ZBN , 5JZ7 , 6YW8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF
128 238
Nerve growth factor family
Domain
Sequence
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAV
RR
A
Sequence length 241
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
  NGF processing
Frs2-mediated activation
ARMS-mediated activation
Retrograde neurotrophin signalling
TRKA activation by NGF
PI3K/AKT activation
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Epilepsy Epilepsy, Tonic-Clonic, Familial, Epilepsy, Tonic-Clonic, Symptomatic rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532 16023256
Glomerulonephritis Glomerulonephritis rs778043831 24244623
Hereditary insensitivity to pain with anhidrosis HSAN Type IV rs914061514, rs121964866, rs35669708, rs121964868, rs121964870, rs80356675, rs80356676, rs80356677, rs80356674, rs398122810, rs606231466, rs606231467, rs797045059, rs797045060, rs879253889, rs879253890, rs1064793219, rs1452844753, rs747711259, rs764171953, rs370483210, rs1363364803, rs759190964, rs1558104865, rs1558105252, rs763758904, rs1485714154, rs1571695851, rs764992664, rs756981419, rs764816792, rs1571685736, rs748672380, rs1232901259, rs747976486, rs1571689751, rs1571696060, rs1571690112, rs763122825, rs1655824699, rs1647277529, rs369353892, rs1648159596, rs780724170, rs768373757
Hereditary sensory and autonomic neuropathy Hereditary Sensory Autonomic Neuropathy, Type 1, Hereditary Sensory Autonomic Neuropathy, Type 2, Hereditary Sensory Autonomic Neuropathy, Type 5, Hereditary Sensory and Autonomic Neuropathies, Hereditary Sensory Radicular Neuropathy, Hereditary sensory and autonomic neuropathy type 5 rs137852739, rs137852737, rs28940291, rs28940294, rs267607089, rs267607091, rs119482081, rs119482083, rs119482082, rs267607087, rs111033592, rs111033590, rs111033591, rs387906331, rs387906332, rs137852736, rs137852738, rs137852734, rs137852735, rs398122819, rs587778791, rs587778798, rs483352920, rs672601370, rs864621998, rs863224970, rs879253939, rs879254294, rs1057519416, rs1057518748, rs746681765, rs1057519295, rs1064795772, rs1085307142, rs1554716504, rs775437084, rs1554093168, rs1184021143, rs1562435373, rs201871537, rs1478989689, rs1242078669, rs759006806, rs1559030991, rs757480516, rs759333796, rs1594986869, rs1580849841, rs1574706911, rs1574843584, rs1580870705, rs1197928094, rs1951910839, rs1601814238, rs1639043704, rs1799544883 14976160, 15131306, 19038341, 20978020, 22302274, 1317267
Unknown
Disease name Disease term dbSNP ID References
Amnesia Amnesia 19694610, 16405025
Anhidrosis Anhidrosis
Cerebral infraction Infarction, Middle Cerebral Artery 10408807
Bright disease Bright Disease 24244623

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412