NFIL3 (nuclear factor, interleukin 3 regulated)

Gene

• Entrez ID: 4783
• Gene name: Nuclear factor, interleukin 3 regulated
• Gene symbol: NFIL3
• Synonyms: E4BP4, IL3BP1, NF-IL3A, NFIL3A
• Chromosome: 9
• Chromosome location: 9q22.31
• Summary: The protein encoded by this gene is a transcriptional regulator that binds as a homodimer to activating transcription factor (ATF) sites in many cellular and viral promoters. The encoded protein represses PER1 and PER2 expression and therefore plays a role in the regulation of circadian rhythm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018550	hsa-miR-335-5p	Microarray	18185580
MIRT027704	hsa-miR-98-5p	Microarray	19088304
MIRT054774	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR	24423866

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20093779
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20093779
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1620116
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1620116, 20093779
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7565758
GO:0005515	Function	Protein binding	IPI	20102225, 21516116, 25416956, 25609649, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006955	Process	Immune response	IEA
GO:0007623	Process	Circadian rhythm	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	1620116
GO:0045892	Process	Negative regulation of transcription, DNA-templated	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0071353	Process	Cellular response to interleukin-4	IEA

Other IDs

• MIM: 605327
• HGNC: 7787
• e!Ensembl: ENSG00000165030

Protein

• UniProt ID: Q16649
• Protein name: Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) (Interleukin-3 promoter transcriptional activator) (Interleukin-3-binding protein 1) (Transcriptional activator NF-IL3A)
• Protein function: Acts as a transcriptional regulator that recognizes and binds to the sequence 5'-[GA]TTA[CT]GTAA[CT]-3', a sequence present in many cellular and viral promoters. Represses transcription from promoters with activating transcription factor (ATF) sites. Represses promoter activity in osteoblasts (By similarity). Represses transcriptional activity of PER1 (By similarity). Represses transcriptional activity of PER2 via the B-site on the promoter (By similarity). Activates transcription from the interleukin-3 promoter in T-cells. Competes for the same consensus-binding site with PAR DNA-binding factors (DBP, HLF and TEF) (By similarity). Component of the circadian clock that acts as a negative regulator for the circadian expression of PER2 oscillation in the cell-autonomous core clock (By similarity). Protects pro-B cells from programmed cell death (By similarity). Represses the transcription of CYP2A5 (By similarity). Positively regulates the expression and activity of CES2 by antagonizing the repressive action of NR1D1 on CES2 (By similarity). Required for the development of natural killer cell precursors (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07716	bZIP_2	72 → 125	Basic region leucine zipper	Coiled-coil
  PF06529	Vert_IL3-reg_TF	130 → 461	Vertebrate interleukin-3 regulated transcription factor	Family

• Sequence:

  MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSAC
  RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
  SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIK
  HSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYT
  ASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH
  SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSK
  RHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD
  SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG

• Sequence length: 462

Pathways

KEGG:

Circadian rhythm

Associated diseases

Disease name	Disease term	References
	Advanced Sleep Phase Syndrome	25395965
	Delayed Sleep Phase Syndrome	25395965
	Non-24 Hour Sleep-Wake Disorder	25395965
	Nonorganic Sleep Wake Cycle Disorders	25395965
	Shift-Work Sleep Disorder	25395965