GediPNet logo

NEUROG1 (neurogenin 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4762
Gene nameGene Name - the full gene name approved by the HGNC.
Neurogenin 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
NEUROG1
SynonymsGene synonyms aliases
AKA, CCDDRD, Math4C, NEUROD3, bHLHa6, ngn1
ChromosomeChromosome number
5
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017336 hsa-miR-335-5p Microarray 18185580
MIRT021004 hsa-miR-155-5p Proteomics 18668040
MIRT438550 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438550 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438550 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003682 Function Chromatin binding ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q92886
Protein name Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3)
Protein function Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcri
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH
93 145
Helix-loop-helix DNA-binding domain
Domain
Sequence
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALA
ETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH
Sequence length 237
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Signaling pathways regulating pluripotency of stem cells  
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 17044100, 18799289
Unknown
Disease name Disease term dbSNP ID References
Schizoaffective disorder Schizoaffective Disorder 18799289

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412