NCK1 (NCK adaptor protein 1)

Gene

• Entrez ID: 4690
• Gene name: NCK adaptor protein 1
• Gene symbol: NCK1
• Synonyms: NCK, NCKalpha, nck-1
• Chromosome: 3
• Chromosome location: 3q22.3
• Summary: The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinas

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT643163	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT643162	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT643161	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT643160	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT643159	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT643158	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT643157	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT643156	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT643155	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT643163	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT643162	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT643161	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT643160	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT643159	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT643158	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT643157	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT643156	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT643155	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT1176361	hsa-miR-142-5p	CLIP-seq
MIRT1176362	hsa-miR-183	CLIP-seq
MIRT1176363	hsa-miR-190	CLIP-seq
MIRT1176364	hsa-miR-190b	CLIP-seq
MIRT1176365	hsa-miR-217	CLIP-seq
MIRT1176366	hsa-miR-3166	CLIP-seq
MIRT1176367	hsa-miR-3167	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT1176369	hsa-miR-340	CLIP-seq
MIRT1176370	hsa-miR-4659a-3p	CLIP-seq
MIRT1176371	hsa-miR-4659b-3p	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT1176373	hsa-miR-4762-3p	CLIP-seq
MIRT1176374	hsa-miR-548an	CLIP-seq
MIRT1176375	hsa-miR-548c-3p	CLIP-seq
MIRT1176376	hsa-miR-586	CLIP-seq
MIRT1176377	hsa-miR-587	CLIP-seq
MIRT1176378	hsa-miR-876-5p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq
MIRT2051057	hsa-miR-141	CLIP-seq
MIRT1176361	hsa-miR-142-5p	CLIP-seq
MIRT1176363	hsa-miR-190	CLIP-seq
MIRT1176364	hsa-miR-190b	CLIP-seq
MIRT2051058	hsa-miR-200a	CLIP-seq
MIRT2051059	hsa-miR-3136-5p	CLIP-seq
MIRT1176367	hsa-miR-3167	CLIP-seq
MIRT1176369	hsa-miR-340	CLIP-seq
MIRT2051060	hsa-miR-3607-5p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2051063	hsa-miR-3924	CLIP-seq
MIRT2051064	hsa-miR-431	CLIP-seq
MIRT2051065	hsa-miR-4439	CLIP-seq
MIRT2051066	hsa-miR-4513	CLIP-seq
MIRT2051067	hsa-miR-4639-3p	CLIP-seq
MIRT1176370	hsa-miR-4659a-3p	CLIP-seq
MIRT1176371	hsa-miR-4659b-3p	CLIP-seq
MIRT2051068	hsa-miR-4711-3p	CLIP-seq
MIRT2051069	hsa-miR-4718	CLIP-seq
MIRT1176373	hsa-miR-4762-3p	CLIP-seq
MIRT2051070	hsa-miR-515-5p	CLIP-seq
MIRT1176376	hsa-miR-586	CLIP-seq
MIRT1176377	hsa-miR-587	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT1176378	hsa-miR-876-5p	CLIP-seq
MIRT2051057	hsa-miR-141	CLIP-seq
MIRT2051058	hsa-miR-200a	CLIP-seq
MIRT2280192	hsa-miR-4264	CLIP-seq
MIRT2280193	hsa-miR-4275	CLIP-seq
MIRT2280194	hsa-miR-4496	CLIP-seq
MIRT2280195	hsa-miR-4666-5p	CLIP-seq
MIRT2280196	hsa-miR-4672	CLIP-seq
MIRT2280197	hsa-miR-4797-3p	CLIP-seq
MIRT2280198	hsa-miR-622	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2280199	hsa-miR-4704-3p	CLIP-seq
MIRT2578690	hsa-miR-137	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT2578691	hsa-miR-3692	CLIP-seq
MIRT2578692	hsa-miR-369-3p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2578693	hsa-miR-4263	CLIP-seq
MIRT2578694	hsa-miR-4436b-5p	CLIP-seq
MIRT2578695	hsa-miR-4504	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT2578696	hsa-miR-4735-5p	CLIP-seq
MIRT2578697	hsa-miR-4775	CLIP-seq
MIRT2578698	hsa-miR-4795-3p	CLIP-seq
MIRT2578699	hsa-miR-542-3p	CLIP-seq
MIRT2578700	hsa-miR-576-5p	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT2578701	hsa-miR-619	CLIP-seq
MIRT2578702	hsa-miR-875-3p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT2578692	hsa-miR-369-3p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2578693	hsa-miR-4263	CLIP-seq
MIRT2578695	hsa-miR-4504	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT2578696	hsa-miR-4735-5p	CLIP-seq
MIRT2578697	hsa-miR-4775	CLIP-seq
MIRT2578699	hsa-miR-542-3p	CLIP-seq
MIRT2578700	hsa-miR-576-5p	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT2578701	hsa-miR-619	CLIP-seq
MIRT2578702	hsa-miR-875-3p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000164	Component	Protein phosphatase type 1 complex	IDA	16835242
GO:0004860	Function	Protein kinase inhibitor activity	IDA	18835251
GO:0005102	Function	Signaling receptor binding	IPI	12110186
GO:0005515	Function	Protein binding	IPI	9346925, 9697839, 10026169, 10206341, 10229072, 10521462, 12620186, 15469942, 15929943, 16273093, 16374509, 16525419, 16636290, 16966330, 17474147, 17617578, 18320063, 18835251, 18955169, 20562827, 21664272, 21725281, 21988832, 22074159, 24658140, 24728074, 25218436, 25241761, 26496
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	NAS	12110186
GO:0005783	Component	Endoplasmic reticulum	IDA	16835242
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IDA	11959995
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0006930	Process	Substrate-dependent cell migration, cell extension	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007172	Process	Signal complex assembly	NAS	12110186
GO:0008093	Function	Cytoskeletal anchor activity	NAS	12110186
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0012506	Component	Vesicle membrane	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	12110186
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IC	16835242
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	21707536
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	12110186
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	23358419
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	IDA	14676213, 16835242
GO:0035591	Function	Signaling adaptor activity	NAS	16835242
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IDA	14676213
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	12110186
GO:0042110	Process	T cell activation	IMP	12110186
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10026169
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	21707536
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051707	Process	Response to other organism	IEA
GO:0060548	Process	Negative regulation of cell death	IDA	18835251
GO:0070262	Process	Peptidyl-serine dephosphorylation	IDA	16835242
GO:0071074	Function	Eukaryotic initiation factor eIF2 binding	IPI	11959995
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	14676213
GO:1903676	Process	Positive regulation of cap-dependent translational initiation	IDA	11959995
GO:1903679	Process	Positive regulation of cap-independent translational initiation	IDA	11959995
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IDA	14676213
GO:1903912	Process	Negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation	IDA	14676213, 16835242
GO:1990441	Process	Negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	16835242

Other IDs

• MIM: 600508
• HGNC: 7664
• e!Ensembl: ENSG00000158092

Protein

• UniProt ID: P16333
• Protein name: SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)
• Protein function: Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role i
• PDB: 2CI8, 2CI9, 2CUB, 2JS0, 2JS2, 2JW4, 5QU1, 5QU2, 5QU3, 5QU4, 5QU5, 5QU6, 5QU7, 5QU8, 5QUA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	8 → 53	SH3 domain	Domain
  PF14604	SH3_9	113 → 161	Variant SH3 domain	Domain
  PF00018	SH3_1	196 → 244	SH3 domain	Domain
  PF00017	SH2	282 → 356	SH2 domain	Domain

• Sequence:

  MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
  SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
  REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
  AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
  LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
  HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
  IFTSEQGEKLYLVKHLS

• Sequence length: 377

Pathways

KEGG:

ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection

Reactome:

Downstream signal transduction
Generation of second messenger molecules
Regulation of actin dynamics for phagocytic cup formation
Nephrin family interactions
DCC mediated attractive signaling
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962, rs751524927, rs1575079076, rs1575446356, rs1478603808, rs1578264146, rs1578673280, rs1579484570, rs1579491104, rs1171390403, rs1582867955, rs764264135, rs951047896, rs890521687, rs1581495906, rs1587941402, rs1003155450, rs1588299621, rs1591100766, rs1591693095, rs1029296641, rs1593107841, rs1208575764, rs1593835248, rs1594406727, rs1594966387, rs1595889508, rs1159294530, rs1597073318, rs1135402871, rs1599413207, rs1418268495, rs1212577459, rs1600394490, rs1455074519, rs1603113792, rs1603415028, rs1602247047, rs1603452612	28112199
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391	19443634

Unknown
Disease name	Disease term	dbSNP ID	References
Hodgkin disease	Hodgkin Disease		28112199
Lymphocytic leukemia	Chronic Lymphocytic Leukemia, Small Lymphocytic Lymphoma		28112199