MYL3 (myosin light chain 3)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
4634 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Myosin light chain 3 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
MYL3 |
SynonymsGene synonyms aliases
|
CMH8, MLC-lV/sb, MLC1SB, MLC1V, VLC1, VLCl |
ChromosomeChromosome number
|
3 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
3p21.31 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs104893748 |
T>C |
Pathogenic |
Missense variant, coding sequence variant |
rs104893749 |
C>A,T |
Pathogenic, likely-pathogenic, uncertain-significance |
Missense variant, coding sequence variant |
rs104893750 |
C>T |
Conflicting-interpretations-of-pathogenicity, pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, uncertain-significance |
Missense variant, coding sequence variant |
rs139794067 |
G>A,C,T |
Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity |
Missense variant, coding sequence variant |
rs145520567 |
C>T |
Uncertain-significance, conflicting-interpretations-of-pathogenicity |
Coding sequence variant, missense variant |
rs150634297 |
C>T |
Uncertain-significance, likely-pathogenic |
Coding sequence variant, missense variant |
rs199474703 |
C>T |
Pathogenic, likely-pathogenic, pathogenic-likely-pathogenic |
Coding sequence variant, missense variant |
rs199474705 |
C>T |
Likely-pathogenic, uncertain-significance |
Coding sequence variant, missense variant |
rs199474706 |
G>C |
Pathogenic, likely-pathogenic |
Coding sequence variant, missense variant |
rs199474707 |
C>A,G,T |
Conflicting-interpretations-of-pathogenicity, uncertain-significance |
Coding sequence variant, missense variant |
rs567723663 |
G>A,C |
Likely-pathogenic |
Intron variant |
rs730880162 |
C>A,T |
Likely-pathogenic |
Missense variant, coding sequence variant |
rs730880954 |
C>T |
Likely-pathogenic, uncertain-significance |
Missense variant, coding sequence variant |
rs730880955 |
G>C |
Likely-pathogenic |
Missense variant, coding sequence variant |
rs730880960 |
G>A,T |
Likely-pathogenic |
Missense variant, coding sequence variant |
rs730880962 |
A>G,T |
Pathogenic, uncertain-significance |
Missense variant, coding sequence variant |
rs869025485 |
C>T |
Likely-pathogenic |
Missense variant, coding sequence variant |
rs869025486 |
C>T |
Likely-pathogenic, uncertain-significance |
Missense variant, coding sequence variant |
rs1064793448 |
G>- |
Pathogenic |
Frameshift variant, coding sequence variant |
rs1427839320 |
C>A,T |
Likely-pathogenic |
Missense variant, coding sequence variant |
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P08590 |
Protein name |
Myosin light chain 3 (Cardiac myosin light chain 1) (CMLC1) (Myosin light chain 1, slow-twitch muscle B/ventricular isoform) (MLC1SB) (Ventricular myosin alkali light chain) (Ventricular myosin light chain 1) (VLCl) (Ventricular/slow twitch myosin alkali light chain) (MLC-lV/sb) |
Protein function |
Regulatory light chain of myosin. Does not bind calcium. |
PDB |
5TBY
|
Family and domains |
|
Sequence |
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN GCINYEAFVKHIMSS
|
|
Sequence length |
195 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Disease name |
Disease term |
References |
|
Breast Carcinoma |
|
|
Cardiomyopathies |
|
Cardiomyopathy, Hypertrophic, Familial |
|
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 8 |
|
Cardiomyopathy, Familial Hypertrophic, 1 (disorder) |
|
|
Hypertrophic Cardiomyopathy |
19035361, 20031618, 25086479, 27483260, 21262909, 25342278, 22131351, 25611685, 11174330, 8417110, 12707239, 26443374, 27532257, 16267253, 18409188, 16675844, 25910212, 18403758, 21239446, 28658286, 23426552, 21823217, 26779504, 12021217, 9927691, 23283745, 8673105 |
NON RARE IN EUROPE: Familial isolated hypertrophic cardiomyopathy |
|
|
Left Ventricular Hypertrophy |
|
|
Restrictive cardiomyopathy |
|
|
Ventricular Fibrillation |
|
|
|
|