Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
4632 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Myosin light chain 1 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
MYL1 |
SynonymsGene synonyms aliases
|
CMYO14, CMYP14, MLC-1, MLC1, MLC1/3, MLC1F, MLC3F, MYOFTA |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2q34 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeleta |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs1259220084 |
A>C,G |
Likely-pathogenic |
Coding sequence variant, missense variant |
rs1559659233 |
T>C |
Pathogenic |
Splice acceptor variant |
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P05976 |
Protein name |
Myosin light chain 1/3, skeletal muscle isoform (MLC1/MLC3) (MLC1F/MLC3F) (Myosin light chain alkali 1/2) (Myosin light chain A1/A2) |
Protein function |
Non-regulatory myosin light chain required for proper formation and/or maintenance of myofibers, and thus appropriate muscle function. |
Family and domains |
|
Sequence |
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFL LFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAI SNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNG CINYEAFVKHIMSI
|
|
Sequence length |
194 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Congenital myopathy |
Congenital myopathy (disorder) |
rs80358247, rs199474720, rs80358248, rs121964852, rs199474719, rs121964853, rs121964854, rs104894129, rs137853306, rs199476153, rs199476147, rs137853307, rs28930068, rs121909519, rs121909521, rs121909522, rs121909523, rs121909524, rs121909529, rs121909531, rs137852801, rs387907072, rs387907073, rs387907196, rs367543049, rs398122936, rs199476146, rs606231257, rs797045950, rs768144106, rs564856283, rs876661406, rs876661407, rs886041584, rs769114543, rs1064794287, rs759242559, rs780703403, rs1421405659, rs1235665641, rs1563929454, rs1179926739, rs1565943228, rs1571893814, rs1567819905, rs1593846841, rs752326328, rs1570098248, rs1176071790, rs1392068839, rs1572148902, rs1572148914, rs1553251644, rs1571456678, rs1558081664, rs147517396, rs1577005361, rs80338778 |
30215711 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Congenital myopathy with reduce muscle fibers |
Congenital myopathy with reduced type 2 muscle fibers |
rs1559659233, rs1259220084 |
|
High palate |
Byzanthine arch palate |
|
|
Motor delay |
Clumsiness - motor delay |
|
|
|