GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

MYD88 (MYD88 innate immune signal transduction adaptor)

Gene

4615

MYD88 innate immune signal transduction adaptor

MYD88

IMD68, MYD88D, WM1

3p22.2

This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853064	C>A,G,T	Pathogenic	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs387907272	T>C	Likely-pathogenic, uncertain-significance, pathogenic	Stop lost, missense variant, coding sequence variant, terminator codon variant, non coding transcript variant

Show/Hide all(297)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23522925
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23522925
MIRT020533	hsa-miR-155-5p	Western blot	21030878
MIRT054356	hsa-miR-21-5p	Chip, ELISA, Flow cytometry, Luciferase reporter assay, QRTPCR, Western blot	23633945
MIRT438020	hsa-miR-149-5p	ELISA, qRT-PCR, Western blot	24375488
MIRT438020	hsa-miR-149-5p	ELISA, qRT-PCR, Western blot	24375488
MIRT438020	hsa-miR-149-5p	ELISA, qRT-PCR, Western blot	24375488
MIRT438020	hsa-miR-149-5p	ELISA, qRT-PCR, Western blot	24375488
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT438020	hsa-miR-149-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31855318
MIRT735107	hsa-miR-124-3p	Western blotting, Immunohistochemistry (IHC)	32850781
MIRT735382	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT736264	hsa-miR-30a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence	31958204
MIRT736431	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT527505	hsa-miR-155-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	32031337
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT755407	hsa-miR-505-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35959879
MIRT735382	hsa-miR-146a-5p	Western blotting	36210830
MIRT1167937	hsa-miR-1224-3p	CLIP-seq
MIRT1167938	hsa-miR-1260	CLIP-seq
MIRT1167939	hsa-miR-1260b	CLIP-seq
MIRT1167940	hsa-miR-1280	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT1167942	hsa-miR-155	CLIP-seq
MIRT1167943	hsa-miR-188-3p	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167946	hsa-miR-2278	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT1167949	hsa-miR-3119	CLIP-seq
MIRT1167950	hsa-miR-3156-3p	CLIP-seq
MIRT1167951	hsa-miR-3199	CLIP-seq
MIRT1167952	hsa-miR-3611	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT1167956	hsa-miR-4252	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167958	hsa-miR-4276	CLIP-seq
MIRT1167959	hsa-miR-4330	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT1167962	hsa-miR-4469	CLIP-seq
MIRT1167963	hsa-miR-4470	CLIP-seq
MIRT1167964	hsa-miR-4476	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT1167966	hsa-miR-4642	CLIP-seq
MIRT1167967	hsa-miR-4666-5p	CLIP-seq
MIRT1167968	hsa-miR-4670-3p	CLIP-seq
MIRT1167969	hsa-miR-4691-5p	CLIP-seq
MIRT1167970	hsa-miR-4693-3p	CLIP-seq
MIRT1167971	hsa-miR-4696	CLIP-seq
MIRT1167972	hsa-miR-4715-5p	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT1167974	hsa-miR-4732-5p	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT1167978	hsa-miR-654-3p	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT2277302	hsa-miR-1343	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2277305	hsa-miR-3166	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT2277308	hsa-miR-3977	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2277312	hsa-miR-4771	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2685626	hsa-miR-1587	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2685627	hsa-miR-4492	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2685628	hsa-miR-4498	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2685629	hsa-miR-4505	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2685630	hsa-miR-4640-5p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2685631	hsa-miR-4656	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2685632	hsa-miR-4674	CLIP-seq
MIRT2685633	hsa-miR-4675	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2685634	hsa-miR-4726-5p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2685635	hsa-miR-4741	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2685636	hsa-miR-762	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT3	Unknown	12244150

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002238	Process	Response to molecule of fungal origin	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0005121	Function	Toll binding	IEA
GO:0005123	Function	Death receptor binding	TAS	9374458
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10880445, 11544529, 12860405, 15728506, 16189514, 16293622, 16365431, 17126326, 17258210, 17567694, 17583698, 19948740, 20676093, 20696886, 21334391, 21829704, 21988832, 22155231, 22581261, 24316379, 25416956, 25502805, 25910212, 26592460, 26871637, 28514442, 29281743, 29990310, 315
GO:0005634	Component	Nucleus	IDA	22155231
GO:0005737	Component	Cytoplasm	IDA	22155231
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006909	Process	Phagocytosis	IMP	30883606
GO:0006915	Process	Apoptotic process	IMP	22155231
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	NAS	9013863
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9374458
GO:0007254	Process	JNK cascade	IEA
GO:0008063	Process	Toll signaling pathway	IBA	21873635
GO:0009615	Process	Response to virus	IEA
GO:0009682	Process	Induced systemic resistance	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IMP	23633945
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032494	Process	Response to peptidoglycan	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	20219467
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0035325	Function	Toll-like receptor binding	IBA	21873635
GO:0042742	Process	Defense response to bacterium	IMP	20219467
GO:0042802	Function	Identical protein binding	IPI	11544529, 17258210, 21516116, 21988832, 22155231, 25416956, 25910212, 27107012, 29892012, 32296183
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043621	Function	Protein self-association	IDA	22155231
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA	21873635
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	22155231
GO:0060337	Process	Type I interferon signaling pathway	IMP	23633945
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15294994
GO:0070976	Function	TIR domain binding	IPI	19509286
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090557	Process	Establishment of endothelial intestinal barrier	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	20219467
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1902622	Process	Regulation of neutrophil migration	IEA
GO:2000338	Process	Regulation of chemokine (C-X-C motif) ligand 1 production	IEA
GO:2000341	Process	Regulation of chemokine (C-X-C motif) ligand 2 production	IEA

MIM	HGNC	e!Ensembl
602170	7562	ENSG00000172936

Protein

UniProt ID

Q99836

Protein name

Myeloid differentiation primary response protein MyD88

Protein function

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:15361868, PubMed:18292575, PubMed:33718825, PubMed:37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa

PDB

2JS7 , 2Z5V , 3MOP , 4DOM , 4EO7 , 6I3N , 7BEQ , 7BER , 7L6W , 8S78 , 8W8M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	30 → 107	Death domain	Domain
PF01582	TIR	163 → 295	TIR domain	Family

Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Sequence length

296

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway NF-kappa B signaling pathway Toll-like receptor signaling pathway NOD-like receptor signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Leishmaniasis Chagas disease African trypanosomiasis Malaria Toxoplasmosis Tuberculosis Hepatitis B Measles Influenza A Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		ER-Phagosome pathway PIP3 activates AKT signaling MyD88:MAL(TIRAP) cascade initiated on plasma membrane RIP-mediated NFkB activation via ZBP1 p75NTR recruits signalling complexes DEx/H-box helicases activate type I IFN and inflammatory cytokines production MyD88 deficiency (TLR2/4) MyD88 deficiency (TLR5) IRAK4 deficiency (TLR5) IRAK4 deficiency (TLR2/4) PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-1 signaling TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation MyD88 dependent cascade initiated on endosome MyD88 cascade initiated on plasma membrane

Associated diseases

Show/Hide Causal Diseases (12)

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Normocytic anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	28789951
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	25049379
Hypertension	Hypertensive disease	rs13306026, rs13333226	27292124
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601
Lymphoma	Lymphoma, Lymphoma, Follicular, Lymphoma, Large-Cell, Follicular, Lymphoma, Mixed-Cell, Follicular, Lymphoma, Small Cleaved-Cell, Follicular, Lymphoma, Follicular, Grade 1, Lymphoma, Follicular, Grade 3, Lymphoma, Follicular, Grade 2	rs11540652, rs1592119138, rs1592123162, rs1599367044	24362818
Migraine	Migraine Disorders	rs794727411
Myd88 deficiency	MYD88 Deficiency	rs137853065, rs878852993	18669862, 19506249, 24316379, 23215570, 21057262
Polyneuropathy	Polyneuropathy	rs1597597437
Renal insufficiency	Renal Insufficiency	rs1596536873
Thrombophilia	Thrombophilia	rs118203912, rs118203911, rs121918141, rs121918142, rs121918143, rs121918144, rs121918145, rs121918146, rs121918147, rs121918148, rs121918149, rs121918151, rs121918152, rs121918153, rs121918154, rs1558715857, rs121918155, rs121918157, rs121918158, rs2104934553, rs121918159, rs121918160, rs121918477, rs121918473, rs121918474, rs267606981, rs2107137679, rs121918475, rs387906674, rs387907201, rs369504169, rs142742242, rs373983977, rs368074804, rs574132670, rs757583846, rs863224838, rs121918476, rs1333329860, rs1553424043, rs1553808038, rs5017717, rs374476971, rs1553809314, rs1553423955, rs767112991, rs1558718572, rs571278160, rs766261022, rs1321566264, rs1559926604, rs1241365457, rs759677822, rs1448630830, rs1305782685, rs1571577365, rs1247269491, rs777486993, rs201907715, rs769277939, rs199469503, rs1575904540, rs199469494, rs199469471, rs1189377845, rs1576182848, rs1688218776, rs1456533664, rs1709033502, rs1708668246, rs1708665916
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771, rs766602945, rs1601419986, rs1489114116, rs754904956, rs755007390, rs368615054

Show/Hide Unknown Diseases (16)

Unknown
Disease name	Disease term	dbSNP ID	References
Anorexia	Anorexia
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569
Cranial nerve paralysis	Cranial nerve palsies
Cryoglobulinemia	Cryoglobulinemia
Cutis marmorata	Cutis marmorata
Eosinophilia	Eosinophilia, Eosinophilia, Tropical		26882889
Immunologic deficiency syndromes	Immunologic Deficiency Syndromes
Malabsorption syndrome	Malabsorption Syndrome
Monoclonal immunoglobulin m proteinemia	Monoclonal immunoglobulin M proteinemia
Nervous system diseases	Peripheral Nervous System Diseases
Pleural effusion	Pleural effusion disorder
Proptosis	Exophthalmos
Pulmonary eosinophilia	Pulmonary Eosinophilia, Simple Pulmonary Eosinophilia		29067999
Stroke	Cerebrovascular accident
Urticaria	Urticaria
Waldenstrom`s macroglobulinemia	Waldenstrom Macroglobulinemia, Waldenstr�m macroglobulinemia, Familial Waldenstrom`s Macroglobulinaemia, MACROGLOBULINEMIA, WALDENSTROM, SUSCEPTIBILITY TO, 1		23532735, 30126942, 23321251, 30126942

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412