MSRA (methionine sulfoxide reductase A)

Gene

• Entrez ID: 4482
• Gene name: Methionine sulfoxide reductase A
• Gene symbol: MSRA
• Synonyms: PMSR
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022647	hsa-miR-124-3p	Microarray	18668037
MIRT1161808	hsa-miR-1228	CLIP-seq
MIRT1161809	hsa-miR-198	CLIP-seq
MIRT1161810	hsa-miR-338-3p	CLIP-seq
MIRT1161811	hsa-miR-342-3p	CLIP-seq
MIRT1161812	hsa-miR-361-3p	CLIP-seq
MIRT1161813	hsa-miR-4267	CLIP-seq
MIRT1161814	hsa-miR-4421	CLIP-seq
MIRT1161815	hsa-miR-4530	CLIP-seq
MIRT1161816	hsa-miR-4793-5p	CLIP-seq
MIRT1161817	hsa-miR-615-5p	CLIP-seq
MIRT1161818	hsa-miR-330-3p	CLIP-seq
MIRT1161819	hsa-miR-4422	CLIP-seq
MIRT1161820	hsa-miR-4760-3p	CLIP-seq
MIRT2275499	hsa-miR-224	CLIP-seq
MIRT2275500	hsa-miR-23a	CLIP-seq
MIRT2275501	hsa-miR-23b	CLIP-seq
MIRT2275502	hsa-miR-23c	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006464	Process	Cellular protein modification process	TAS	10452521
GO:0006555	Process	Methionine metabolic process	TAS	10452521
GO:0006979	Process	Response to oxidative stress	TAS	10452521
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	IBA	21873635
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	TAS
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0030091	Process	Protein repair	TAS
GO:0034599	Process	Cellular response to oxidative stress	IBA	21873635
GO:0036456	Function	L-methionine-(S)-S-oxide reductase activity	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 601250
• HGNC: 7377
• e!Ensembl: ENSG00000175806

Protein

• UniProt ID: Q9UJ68
• Protein name: Mitochondrial peptide methionine sulfoxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) (Protein-methionine-S-oxide reductase) (PMSR)
• Protein function: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01625	PMSR	67 → 221	Peptide methionine sulfoxide reductase	Family

• Sequence:

  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
  FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
  VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
  KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Sequence length: 235

Pathways

Reactome:

Protein repair

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Chronic obstructive asthma (with obstructive pulmonary disease)	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	30657218
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21679298, 28991256, 18506707, 26198764, 30285260, 31374203

Unknown
Disease name	Disease term	dbSNP ID	References
Anxiety disorder	Anxiety		29942085
Barrett esophagus	Barrett Esophagus	rs41341748	27527254
Esophageal cancer	Adenocarcinoma Of Esophagus		27527254
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	29559929