ASNS (asparagine synthetase (glutamine-hydrolyzing))

Gene

• Entrez ID: 440
• Gene name: Asparagine synthetase (glutamine-hydrolyzing)
• Gene symbol: ASNS
• Synonyms: ASNSD, TS11
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020723	hsa-miR-155-5p	Proteomics	18668040
MIRT029495	hsa-miR-26b-5p	Microarray	19088304
MIRT031665	hsa-miR-16-5p	Proteomics	18668040
MIRT040401	hsa-miR-615-3p	CLASH	23622248
MIRT047059	hsa-miR-183-5p	CLASH	23622248
MIRT050405	hsa-miR-23a-3p	CLASH	23622248
MIRT050820	hsa-miR-17-5p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Activation	12881527
ATF3	Unknown	15385533
ATF4	Activation	11960987;16164412;17276738
ATF4	Unknown	15385533;23403946
CEBPB	Unknown	15385533
DDIT3	Repression	18940792
WWTR1	Repression	22470139

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IEA
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IBA	21873635
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IDA	2564390, 2569668, 2573597, 2886907, 16023613
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006529	Process	Asparagine biosynthetic process	IBA	21873635
GO:0006529	Process	Asparagine biosynthetic process	IC	2564390
GO:0006529	Process	Asparagine biosynthetic process	IDA	2573597
GO:0006541	Process	Glutamine metabolic process	IEA
GO:0008652	Process	Cellular amino acid biosynthetic process	TAS
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0031427	Process	Response to methotrexate	IEA
GO:0032354	Process	Response to follicle-stimulating hormone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0036499	Process	PERK-mediated unfolded protein response	TAS
GO:0042149	Process	Cellular response to glucose starvation	IDA	10085239
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17409444
GO:0043200	Process	Response to amino acid	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	2569668
GO:0070981	Process	L-asparagine biosynthetic process	IEA

Other IDs

• MIM: 108370
• HGNC: 753
• e!Ensembl: ENSG00000070669

Protein

• UniProt ID: P08243
• Protein name: Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase)
• PDB: 6GQ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13537	GATase_7	47 → 166	Glutamine amidotransferase domain	Domain
  PF00733	Asn_synthase	234 → 395	Asparagine synthase	Domain
  PF00733	Asn_synthase	381 → 547	Asparagine synthase	Domain

• Sequence:

  MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
  PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
  FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
  LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
  NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
  KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
  IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
  LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
  WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
  WINATDPSARTLTHYKSAVKA

• Sequence length: 561

Pathways

KEGG:

Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of amino acids

Reactome:

Aspartate and asparagine metabolism

Associated diseases

Disease name	Disease term	References
	ASPARAGINE SYNTHETASE DEFICIENCY	25758715, 27422383, 27711071, 27743885, 29375865, 29279279, 25227173, 30057589, 24139043, 27469131, 30315573, 4295091, 27522229, 26395554, 25663424, 28776279, 26318253, 29405484
	Central visual impairment
	Cerebellar Hypoplasia
	Congenital microcephaly-severe encephalopathy-progressive cerebral atrophy syndrome
	Cortical Dysplasia
	Profound global developmental delay
	Diaphragmatic Eventration
	Encephalopathies
	Hypoplasia of corpus callosum
	Lipoidosis	17175557
	Liver neoplasms	28108177
	Malignant neoplasm of liver	28108177
	Macrotia
	Micrognathism
	Spastic Quadriplegia