GediPNet logo

MPV17 (mitochondrial inner membrane protein MPV17)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4358
Gene nameGene Name - the full gene name approved by the HGNC.
Mitochondrial inner membrane protein MPV17
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MPV17
SynonymsGene synonyms aliases
CMT2EE, MTDPS6, SYM1
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). [provided by
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35759430 G>A,C Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs113055360 T>C,G Pathogenic Splice acceptor variant
rs121909721 C>T Pathogenic 5 prime UTR variant, coding sequence variant, missense variant
rs121909723 G>A Pathogenic 5 prime UTR variant, coding sequence variant, missense variant
rs121909724 C>T Likely-pathogenic Stop gained, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023393 hsa-miR-122-5p Microarray 17612493
MIRT030312 hsa-miR-26b-5p Microarray 19088304
MIRT046366 hsa-miR-23b-3p CLASH 23622248
MIRT045337 hsa-miR-185-5p CLASH 23622248
MIRT1156970 hsa-miR-1207-5p CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000002 Process Mitochondrial genome maintenance IMP 16582910
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005739 Component Mitochondrion IDA 16582910
GO:0005743 Component Mitochondrial inner membrane IDA 16582910
GO:0005777 Component Peroxisome IDA 16582910
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P39210
Protein name Mitochondrial inner membrane protein Mpv17 (Protein Mpv17)
Protein function Non-selective channel that modulates the membrane potential under normal conditions and oxidative stress, and is involved in mitochondrial homeostasis (PubMed:25861990). Involved in mitochondrial deoxynucleoside triphosphates (dNTP) pool homeost
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04117 Mpv17_PMP22
109 170
Mpv17 / PMP22 family
Family
Sequence
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG
FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW
AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLS
WKAHRL
Sequence length 176
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Peroxisome   Peroxisomal protein import
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Cholestasis Cholestasis rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 18695062
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Liver failure Liver Failure, Liver Failure, Acute rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682 18695062
Nystagmus Nystagmus rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Unknown
Disease name Disease term dbSNP ID References
Cirrhosis Cirrhosis rs119465999, rs144369314, rs8056684, rs112053857, rs75998507
Cochlear diseases Cochlear Diseases 18818194
Distal amyotrophy Distal amyotrophy rs1457770815
Distal lower limb amyotrophy Distal lower limb amyotrophy

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412