MPST (mercaptopyruvate sulfurtransferase)

Gene

• Entrez ID: 4357
• Gene name: Mercaptopyruvate sulfurtransferase
• Gene symbol: MPST
• Synonyms: MST, TST2, TUM1
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016463	hsa-miR-193b-3p	Microarray	20304954
MIRT021491	hsa-miR-191-5p	Sequencing	20371350
MIRT1156968	hsa-miR-298	CLIP-seq
MIRT1156969	hsa-miR-4633-3p	CLIP-seq
MIRT2274152	hsa-miR-105	CLIP-seq
MIRT2274153	hsa-miR-1273f	CLIP-seq
MIRT2274154	hsa-miR-1343	CLIP-seq
MIRT2274155	hsa-miR-143	CLIP-seq
MIRT2274156	hsa-miR-191	CLIP-seq
MIRT2274157	hsa-miR-219-1-3p	CLIP-seq
MIRT2274158	hsa-miR-3176	CLIP-seq
MIRT2274159	hsa-miR-3622a-3p	CLIP-seq
MIRT2274160	hsa-miR-3622b-3p	CLIP-seq
MIRT2274161	hsa-miR-3922-3p	CLIP-seq
MIRT2274162	hsa-miR-4682	CLIP-seq
MIRT2274163	hsa-miR-4708-5p	CLIP-seq
MIRT2274164	hsa-miR-4715-3p	CLIP-seq
MIRT2274165	hsa-miR-4770	CLIP-seq
MIRT2274166	hsa-miR-571	CLIP-seq
MIRT2274167	hsa-miR-95	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000098	Process	Sulfur amino acid catabolic process	TAS
GO:0001822	Process	Kidney development	IEA
GO:0001889	Process	Liver development	IEA
GO:0004792	Function	Thiosulfate sulfurtransferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IEA
GO:0009440	Process	Cyanate catabolic process	TAS
GO:0009636	Process	Response to toxic substance	TAS
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	ISS
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	TAS
GO:0019346	Process	Transsulfuration	IBA	21873635
GO:0021510	Process	Spinal cord development	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070814	Process	Hydrogen sulfide biosynthetic process	ISS

Other IDs

• MIM: 602496
• HGNC: 7223
• e!Ensembl: ENSG00000128309

Protein

• UniProt ID: P25325
• Protein name: 3-mercaptopyruvate sulfurtransferase (MST) (EC 2.8.1.2)
• Protein function: Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), cont
• PDB: 3OLH, 4JGT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00581	Rhodanese	12 → 138	Rhodanese-like domain	Domain
  PF00581	Rhodanese	165 → 282	Rhodanese-like domain	Domain

• Sequence:

  MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
  DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
  GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
  VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
  SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

• Sequence length: 297

Pathways

KEGG:

Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Sulfur relay system

Reactome:

Degradation of cysteine and homocysteine

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	25205294