GediPNet logo

MPL (MPL proto-oncogene, thrombopoietin receptor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4352
Gene nameGene Name - the full gene name approved by the HGNC.
MPL proto-oncogene, thrombopoietin receptor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MPL
SynonymsGene synonyms aliases
C-MPL, CD110, MPLV, THCYT2, THPOR, TPOR
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.2
SummarySummary of gene provided in NCBI Entrez Gene.
In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data re
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs17292650 G>T Benign, not-provided, likely-benign, risk-factor Coding sequence variant, missense variant
rs28928907 G>A,C Pathogenic, not-provided Coding sequence variant, missense variant
rs28928908 C>A,T Pathogenic Coding sequence variant, missense variant
rs41269541 C>T Benign, conflicting-interpretations-of-pathogenicity, likely-benign Intron variant
rs121913610 C>A,G,T Pathogenic Stop gained, missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006402 hsa-miR-28-5p Luciferase reporter assay, qRT-PCR, Western blot 20445018
MIRT006402 hsa-miR-28-5p Luciferase reporter assay, qRT-PCR, Western blot 20445018
MIRT006402 hsa-miR-28-5p Luciferase reporter assay, qRT-PCR, Western blot 20445018
MIRT006403 hsa-let-7c-5p Luciferase reporter assay 20445018
MIRT006404 hsa-let-7e-5p Luciferase reporter assay 20445018
Transcription factors
Transcription factor Regulation Reference
FLI1 Activation 15466856
GATA1 Activation 15466856
RUNX1 Unknown 18687690
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001780 Process Neutrophil homeostasis IEA
GO:0005515 Function Protein binding IPI 24931576
GO:0005794 Component Golgi apparatus IDA 25538044
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P40238
Protein name Thrombopoietin receptor (TPO-R) (Myeloproliferative leukemia protein) (Proto-oncogene c-Mpl) (CD antigen CD110)
Protein function Receptor for thrombopoietin that regulates hematopoietic stem cell renewal, megakaryocyte differentiation, and platelet formation. Upon activation by THPO, induces rapid tyrosine phosphorylation and activation of JAK2, providing docking sites fo
PDB 8G04
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09067 EpoR_lig-bind
25 128
Erythropoietin receptor, ligand binding
Domain
PF00041 fn3
391 475
Fibronectin type III domain
Domain
Sequence
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVD
SVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWS
SWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Sequence length 635
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Cytokine-cytokine receptor interaction
Hormone signaling
JAK-STAT signaling pathway
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Congenital amegakaryocytic thrombocytopenia Congenital amegakaryocytic thrombocytopenia rs121913610, rs121913611, rs121913612, rs28928907, rs587778514, rs146249964, rs750046020, rs587778515, rs148434485, rs770457041, rs1553128241, rs760797899, rs1343123940, rs754859909, rs755257605, rs763568293, rs751975712, rs769297582, rs775250202, rs1647059319 28859041, 16470591, 24728327, 19302922, 21489838, 25538044, 11133753, 18240171, 24438083, 27418648, 18422784, 18024606, 19036112, 21659346, 10971406, 23625800, 17666371, 11972523, 8073287, 22180433
Hemangioma Hemangioma rs119475040, rs121917766
Hypertension Hypertensive disease rs13306026, rs13333226
Unknown
Disease name Disease term dbSNP ID References
Amegakaryocytic thrombocytopenia Amegakaryocytic thrombocytopenia
Anorexia Anorexia
Budd-chiari syndrome Budd-Chiari Syndrome rs6025, rs9332701, rs6009, rs369516642, rs9332607, rs9287090, rs1046712, rs1800594, rs6032, rs4525, rs6018, rs6031, rs6021, rs6024, rs6017, rs6016, rs6037, rs6036, rs6015, rs6033, rs9332578, rs6023, rs6022, rs6029, rs6019, rs6028, rs2187952, rs75764442, rs9332678, rs191866237, rs9332673, rs188490117, rs886045539, rs886045540, rs773618429, rs886045543, rs148772659, rs200865371, rs149092241, rs6026, rs6011, rs144262027, rs13306334, rs139573207, rs13306332, rs369276714, rs6005, rs144979314, rs201078171, rs758832130, rs748350385, rs148752831, rs143152035, rs145625079, rs886045534, rs72708013, rs886045536, rs544753372, rs72708017, rs886045537, rs181328696, rs186962725, rs757104503, rs35369423, rs759428783, rs6008, rs199568344, rs141589936, rs751749207, rs886045547, rs149048805, rs886045548, rs149067268, rs199507543, rs9332695, rs370739570, rs375739973, rs537081933, rs9332485, rs41272465, rs886045552, rs9332677, rs9332675, rs376103455, rs6427196, rs886045535, rs559071301, rs753366128, rs9332676, rs2040444, rs9332674, rs886045538, rs534748300, rs180742904, rs115882472, rs886045541, rs372005449, rs182566496, rs886045542, rs374815777, rs886045544, rs886045545, rs6010, rs886045546, rs763080313, rs200204656, rs559683767, rs543751483, rs373880789, rs6006, rs41272457, rs115148599, rs9332608, rs188882337, rs886045549, rs146408488, rs575766548, rs776949074, rs141768227, rs9332604, rs886045550, rs574610215, rs1557573, rs201510575, rs112333778, rs886045551, rs6020, rs781434840, rs200934105, rs116416322, rs543172813, rs529050943, rs1057515594, rs1038207109, rs1057515590, rs1057515597, rs139964957, rs1057515601, rs143509841, rs41272455, rs373172802, rs6007, rs6034, rs150104888, rs747456938, rs185294741
Defect of skull ossification Defect of skull ossification

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412